KEGG   Desulfurococcus kamchatkensis: DKAM_0929Help
Entry
DKAM_0929         CDS       T00817                                 

Definition
AcdB acetate--coA ligase beta chain
Orthology
K01905  
acetyl-CoA synthetase (ADP-forming) [EC:6.2.1.13]
Organism
dka  Desulfurococcus kamchatkensis
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dka00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DKAM_0929
   00620 Pyruvate metabolism
    DKAM_0929
   00640 Propanoate metabolism
    DKAM_0929
Enzymes [BR:dka01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.13  acetate---CoA ligase (ADP-forming)
     DKAM_0929
Lipid biosynthesis proteins [BR:dka01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   DKAM_0929
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(882472..883170)
Genome map
AA seq 232 aa AA seqDB search
MSPRDILAAALKEKRFKLLEHEAFQIIKYYGIPSPEVVVVKSPAEAVELADKIGYPIALK
IVSPDITHKSDVGGVKLGLKSREEVGKAVEEMLRTVSLKAPNARLVGVLMYNMAPQGLEV
IVGGVRDGIFGPVIMFGLGGIFVEVLKDVSFRIAPITRNDALGMLNEIKSSKILEGYRGQ
PPVDKEAIADIIVKTARLMEENPEIESIDLNPVMAYPKGAIAVDARIILKQG
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgtctccacgtgacatattagctgcagcacttaaggaaaaaaggttcaaactattggag
catgaggcgttccaaataattaaatactatgggatcccatccccggaggtagtggttgtt
aaatcaccagcagaggcagtggagctagctgataaaatagggtatccaatagcgttgaaa
atagtgtccccggatataacacataagagtgatgtaggcggtgtgaaactagggctcaag
agtagagaggaggttggaaaagcggttgaagaaatgcttagaacagtgtctcttaaagca
ccaaatgctagactagtgggggtgttaatgtataacatggctccacaaggactcgaggta
attgttggcggggtgagagacggcatatttgggccagtaataatgttcgggctgggcggt
atattcgttgaggtattaaaggatgtttcattcaggatagcccctattacaaggaacgat
gcattgggaatgcttaatgagatcaagtcgtcgaaaatactcgagggctaccgtggccag
ccgccagtcgataaggaggccatagctgatataatcgttaaaacagctagattaatggag
gagaaccctgagatagaatcaatagatttaaacccggtgatggcctaccctaagggggct
atagctgtcgacgcgaggatcatacttaaacagggttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system