KEGG   Desulfurococcus kamchatkensis: DKAM_0975Help
Entry
DKAM_0975         CDS       T00817                                 

Definition
aldehyde ferredoxin oxidoreductase
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
dka  Desulfurococcus kamchatkensis
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dka00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DKAM_0975
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    DKAM_0975
Enzymes [BR:dka01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     DKAM_0975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
921280..923112
Genome map
AA seq 610 aa AA seqDB search
MYMYGWWGKALLIDLTKSKVKEVSIEPDILHGFIGGRGLAVRLLWDLIPPGVDPLSPYNA
LIVASGPLSGLPLPSSGKLVVASKSPLTNGYGDGNIGSMASHHLKHSGYDALIITGASKK
PVYLYIENGKVDFRSAEDLWGLDTFTTEEKLVREHGRNIGILEIGPAGEHMVRYATVISQ
KGRSGGRPGMGAVMGSKKLKAIVIKGNMEPPIADKEALRKISEESYKKIQGSDNYDYWIR
QGTMSTIQWSHQNSVLPTMNFREGMWELYETISGDLMEKLKIDRRGCPYCNMQCGNVVSD
DVGEESELDYENVAMLGSNILLENLKRVAEINKLADKLGVDTISLGNSIGFYMEASERGL
VKERVEWGDFKAVREITIDTAYRRGLGAFIAEGVMRMARSIGGEALDFAMHVKGLEVSAY
NCHTTPGMALAYGTSSIGAHHKDAWIISYEVRTDRSSYSRDKVERLIFLQNMRGGMFESL
TTCRLPWVEVGLDLEYYPRFLSAVTGLKWSLDDISVSANRIYTLIRAFWIREYMGWSSSM
DYPPTRWFKHPLTKGPYAGSHLDISKYSEMLKIYYEIRGWDENGVPKKETLIKLGLDFTI
PVLEDIVKLR
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgtatatgtatggctggtggggtaaggcactactaatagatttaaccaaaagtaaggta
aaagaggtgagcatagagccagatatactacatggattcatcggtggaagaggcctagcg
gttagactcctatgggatctaatccctcccggagtggatccgttatcaccatataatgca
ttaatagtggcctccggtcctctctcagggctaccattacctagtagtggtaaactagtt
gtagcatctaagagcccgctgacaaatggctatggggatggcaatataggttccatggcc
agccaccacttaaagcacagcggctacgatgcactcataatcacaggggcatctaagaaa
cccgtctacctctacattgaaaacggtaaagtagatttcagaagtgccgaggatctatgg
gggcttgacaccttcactactgaggaaaaactggttagagaacatggtagaaacattggc
atacttgaaatcgggccggcgggagagcatatggttagatacgccacagtgatctcccag
aaggggagaagcggagggcgcccaggcatgggtgctgtaatgggtagcaaaaagctgaag
gcgatagtgatcaagggaaacatggagccacctatagccgataaagaggctcttagaaaa
atatctgaggaatcctataagaagatacagggtagcgataactatgattactggattaga
caaggcacaatgtccacaatacagtggagtcatcaaaacagcgtcctacccacaatgaac
tttagggagggtatgtgggagctgtatgaaaccataagcggtgatttaatggaaaaactg
aagatagatagaaggggatgtccttactgtaacatgcagtgcggtaatgttgttagtgat
gatgtaggagaggagagcgaactagactatgagaacgtagcgatgctgggcagtaatata
ttattagagaacttgaaaagggttgccgagataaataagctagctgataaactaggggta
gataccataagtctaggcaactcgatagggttctatatggaagctagcgagagagggcta
gtcaaagagagagttgaatggggagacttcaaagccgtgagagagataaccattgatacg
gcatatagacgcgggctgggagcattcatagctgaaggagttatgaggatggcaaggagt
attggcggtgaggcactcgatttcgccatgcatgtgaagggtttagaggtatctgcatac
aactgtcacacaacccccggaatggccctagcatacggcacatcttctatcggggcccac
cacaaggatgcctggataataagctacgaagttagaacagatagatcatcgtatagcagg
gacaaggttgaacgcttaatcttcctgcaaaacatgcgtggaggaatgtttgagtcgctg
acaacatgtaggcttccatgggttgaagtaggcctcgacctcgagtattacccaagattc
ctttcagctgtaactggtttaaaatggagcctcgacgatataagcgtttctgccaacagg
atctacacgttgataagggcattctggatacgcgaatacatgggttggagtagctcgatg
gactacccgcctaccagatggtttaaacacccacttacaaaaggaccgtatgcaggctca
cacctagatatctctaaatacagtgaaatgttaaagatatactatgaaatacgtggctgg
gatgaaaacggtgtcccaaagaaggagactctcataaagctggggctagacttcacaata
cctgttctagaggacattgtgaagctacggtag

DBGET integrated database retrieval system