KEGG   Desulfurococcus kamchatkensis: DKAM_0975Help
Entry
DKAM_0975         CDS       T00817                                 

Definition
aldehyde ferredoxin oxidoreductase
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
dka  Desulfurococcus kamchatkensis
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:dka01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:dka00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
921280..923112
Genome map
AA seq 610 aa AA seqDB search
MYMYGWWGKALLIDLTKSKVKEVSIEPDILHGFIGGRGLAVRLLWDLIPPGVDPLSPYNA
LIVASGPLSGLPLPSSGKLVVASKSPLTNGYGDGNIGSMASHHLKHSGYDALIITGASKK
PVYLYIENGKVDFRSAEDLWGLDTFTTEEKLVREHGRNIGILEIGPAGEHMVRYATVISQ
KGRSGGRPGMGAVMGSKKLKAIVIKGNMEPPIADKEALRKISEESYKKIQGSDNYDYWIR
QGTMSTIQWSHQNSVLPTMNFREGMWELYETISGDLMEKLKIDRRGCPYCNMQCGNVVSD
DVGEESELDYENVAMLGSNILLENLKRVAEINKLADKLGVDTISLGNSIGFYMEASERGL
VKERVEWGDFKAVREITIDTAYRRGLGAFIAEGVMRMARSIGGEALDFAMHVKGLEVSAY
NCHTTPGMALAYGTSSIGAHHKDAWIISYEVRTDRSSYSRDKVERLIFLQNMRGGMFESL
TTCRLPWVEVGLDLEYYPRFLSAVTGLKWSLDDISVSANRIYTLIRAFWIREYMGWSSSM
DYPPTRWFKHPLTKGPYAGSHLDISKYSEMLKIYYEIRGWDENGVPKKETLIKLGLDFTI
PVLEDIVKLR
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgtatatgtatggctggtggggtaaggcactactaatagatttaaccaaaagtaaggta
aaagaggtgagcatagagccagatatactacatggattcatcggtggaagaggcctagcg
gttagactcctatgggatctaatccctcccggagtggatccgttatcaccatataatgca
ttaatagtggcctccggtcctctctcagggctaccattacctagtagtggtaaactagtt
gtagcatctaagagcccgctgacaaatggctatggggatggcaatataggttccatggcc
agccaccacttaaagcacagcggctacgatgcactcataatcacaggggcatctaagaaa
cccgtctacctctacattgaaaacggtaaagtagatttcagaagtgccgaggatctatgg
gggcttgacaccttcactactgaggaaaaactggttagagaacatggtagaaacattggc
atacttgaaatcgggccggcgggagagcatatggttagatacgccacagtgatctcccag
aaggggagaagcggagggcgcccaggcatgggtgctgtaatgggtagcaaaaagctgaag
gcgatagtgatcaagggaaacatggagccacctatagccgataaagaggctcttagaaaa
atatctgaggaatcctataagaagatacagggtagcgataactatgattactggattaga
caaggcacaatgtccacaatacagtggagtcatcaaaacagcgtcctacccacaatgaac
tttagggagggtatgtgggagctgtatgaaaccataagcggtgatttaatggaaaaactg
aagatagatagaaggggatgtccttactgtaacatgcagtgcggtaatgttgttagtgat
gatgtaggagaggagagcgaactagactatgagaacgtagcgatgctgggcagtaatata
ttattagagaacttgaaaagggttgccgagataaataagctagctgataaactaggggta
gataccataagtctaggcaactcgatagggttctatatggaagctagcgagagagggcta
gtcaaagagagagttgaatggggagacttcaaagccgtgagagagataaccattgatacg
gcatatagacgcgggctgggagcattcatagctgaaggagttatgaggatggcaaggagt
attggcggtgaggcactcgatttcgccatgcatgtgaagggtttagaggtatctgcatac
aactgtcacacaacccccggaatggccctagcatacggcacatcttctatcggggcccac
cacaaggatgcctggataataagctacgaagttagaacagatagatcatcgtatagcagg
gacaaggttgaacgcttaatcttcctgcaaaacatgcgtggaggaatgtttgagtcgctg
acaacatgtaggcttccatgggttgaagtaggcctcgacctcgagtattacccaagattc
ctttcagctgtaactggtttaaaatggagcctcgacgatataagcgtttctgccaacagg
atctacacgttgataagggcattctggatacgcgaatacatgggttggagtagctcgatg
gactacccgcctaccagatggtttaaacacccacttacaaaaggaccgtatgcaggctca
cacctagatatctctaaatacagtgaaatgttaaagatatactatgaaatacgtggctgg
gatgaaaacggtgtcccaaagaaggagactctcataaagctggggctagacttcacaata
cctgttctagaggacattgtgaagctacggtag

DBGET integrated database retrieval system