KEGG   Desulfurococcus kamchatkensis: DKAM_1041Help
Entry
DKAM_1041         CDS       T00817                                 

Definition
succinyl-CoA synthetase subunit beta
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
dka  Desulfurococcus kamchatkensis
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dka00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DKAM_1041
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DKAM_1041
   00640 Propanoate metabolism
    DKAM_1041
   00660 C5-Branched dibasic acid metabolism
    DKAM_1041
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    DKAM_1041
Enzymes [BR:dka01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     DKAM_1041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(987619..988758)
Genome map
AA seq 379 aa AA seqDB search
MKLYEYEGKEIARKYGIETPRGILATSVEDVDKAYRELNTGTVVLKSQVLVGGRGLAGGV
KKASNLEEALTKARELFSMSIKGERVEKILVEEAVCISRELYMSLTVDRATRKLVYLASG
MGGVEIEELARKHPDKILRIPVDPFIGYSGYMARHALGFLGLQWDKLGQLDNIMRAMYKI
MIDYDAELVEFNPLAYTCDGRLTALDAKIIIDDNSLYRHPDLQPLYGRDATPYEKVAKQL
DFNYVELDGDIGVISNGAGLTMATMDSILHYGGRPANFLDIGGGATRERVREAVKIVVTH
PRVKAVLVNIFGGITRCDEVASGIVEALSETKVAKPIVVRMLGTNEEEGRRILIEHGITV
YTEMDEAVLRIIQLVRGVG
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtatgagtatgaaggtaaggagatagctaggaagtatggtattgagacccct
agaggcatccttgcaacaagtgttgaggatgtggataaggcatatagagagttgaacacg
gggacagtagtattaaaatcccaggtgctcgtgggcggtagaggcctggccggtggagta
aagaaggctagtaacctggaggaggcccttacgaaggcgagggagctcttctcgatgagc
attaagggtgagagggttgaaaaaatactggtggaggaggctgtgtgtatcagtagagag
ctttacatgtctctcactgttgatagggctactagaaaactagtctaccttgcctcaggt
atgggcggtgttgaaatagaggagctagctagaaaacaccctgataaaatactcaggata
cccgtagacccgttcataggatatagtggctacatggctaggcatgcacttgggttcctt
ggtcttcaatgggataaactaggacagctcgacaacatcatgagagctatgtataaaata
atgattgactatgacgcggaactagtggagttcaatcccttagcctacacgtgtgatggg
aggcttacagcgctggatgcaaagataatcatagatgataacagcttatacaggcacccc
gatcttcagcctttatacgggagggatgctaccccctatgagaaagtagctaagcaactc
gacttcaattatgtcgagcttgatggagacataggggtgataagtaatggagccgggtta
acaatggccaccatggactcgattctacattatggtgggagaccagccaacttcctcgat
attggtgggggtgctacgcgtgagagggtcagggaggcagttaaaatagtggtcacccat
ccaagggtcaaggcagtgttagtcaatatatttggcggtataaccaggtgcgatgaagtg
gcctctggaatcgttgaagccctaagtgaaaccaaggtggctaaacccatcgtggttaga
atgcttggcaccaatgaggaggagggcaggaggatacttattgagcatggtataactgtt
tacacggagatggatgaagcagtattaaggattatccaattagtcaggggggtgggctga

DBGET integrated database retrieval system