KEGG   Desulfurococcus kamchatkensis: DKAM_1067Help
Entry
DKAM_1067         CDS       T00817                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
dka  Desulfurococcus kamchatkensis
Brite
Enzymes [BR:dka01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     DKAM_1067 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1011771..1012454
Genome map
AA seq 227 aa AA seqDB search
MSGLEEQKRLIIEELHSLGYLRSEKVIKALLKVPRELFLPPHLREYAYVDTPLPIGFGQT
ISAIHMVAIMTEELDPAPGDRVLEVGTGSGYQAAVLAEIVARSGEGKKGHVYTIERIPEL
AEYARKRLEEAGYSSDVTVIVGDGTLGLPEKAPFDKIIVTAAAPYVPNPLIEQLAEGGRL
VIPVGDVYLQRLLTVEKYGSSITKRYGIECVFVPLIGKYGWHTDSTY
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
ttgtccggtttagaagaacaaaaacgactcattattgaagaactacactcactaggctat
ctgagaagcgagaaagtcataaaagcccttctcaaagtccccagggagctctttctacct
ccacatctaagggagtacgcctatgttgatacacctctcccaataggtttcggtcaaacc
ataagcgcgatacatatggtagccataatgacagaggagttggaccctgccccaggcgat
agggttctcgaggtgggaactggttcaggttatcaggcagctgtactggcagagatagtt
gcaaggagtggtgaggggaaaaaaggacatgtatacactatagaaaggatcccggagctg
gccgagtatgctagaaagcgccttgaggaagctggttatagcagtgatgtcacggtgata
gtgggcgatggaacactggggctacctgagaaagcaccattcgataaaataatagtcaca
gccgccgccccctatgtaccgaacccattaatagagcagctggctgaaggaggaagatta
gtcatacccgtaggcgatgtatatctccaacgactactcacagtagagaagtacgggagt
tcgataaccaagaggtatggaatagaatgtgtgttcgtaccgttaattggtaagtatgga
tggcataccgattcaacatattga

DBGET integrated database retrieval system