KEGG   Desulfurococcus amylolyticus 1221n: DKAM_1133Help
Entry
DKAM_1133         CDS       T00817                                 

Definition
(GenBank) Alcohol dehydrogenase, zinc-containing
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
dka  Desulfurococcus amylolyticus 1221n
Pathway
dka00010  Glycolysis / Gluconeogenesis
dka00071  Fatty acid degradation
dka00350  Tyrosine metabolism
dka00625  Chloroalkane and chloroalkene degradation
dka00626  Naphthalene degradation
dka01100  Metabolic pathways
dka01110  Biosynthesis of secondary metabolites
dka01120  Microbial metabolism in diverse environments
dka01130  Biosynthesis of antibiotics
dka01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:dka00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DKAM_1133
  Lipid metabolism
   00071 Fatty acid degradation
    DKAM_1133
  Amino acid metabolism
   00350 Tyrosine metabolism
    DKAM_1133
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    DKAM_1133
   00626 Naphthalene degradation
    DKAM_1133
Enzymes [BR:dka01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     DKAM_1133
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: ACL11459
UniProt: B8D5S8
Position
complement(1065752..1066765)
Genome map
AA seq 337 aa AA seqDB search
MYTLRAMVLYSPAPVESRPLKYMDVEKPSPGRGEVLIRILKCGVCRTDLHIVEGELKPVK
LPLIPGHQVIGVVEDVGEGVEGVRRGERVGVPWLYYACGECRYCRRGLENLCENALFTGY
SVDGGYAEYMVAKAGFIHRIPDGIDDTHAAPLMCAGAIGYRSLKLTGLLGKGDATLGLFG
YGAAAHLVLQVARRLGLRVYVFTSNRWKIEKALENGAEWAGSTSEEPPRRLDAAIVYAPV
SSVFIEALKKIDKGGRVVLAEIYMTPIEQLDYSLLWHEKEVKSVANVTRKDVGEFLEVAS
RHGVKPEVKTYRLSEANEALIELKKGGHLGQLVLDVA
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
gtgtatacgttgagggcgatggttctctattctccagctcctgtcgagtcaaggccgttg
aaatacatggatgtcgagaaaccaagccccggtagaggcgaggtcttgataaggatcctc
aaatgcggcgtgtgtaggacggatctccacattgttgaaggcgagttgaaacctgtaaag
ctcccactgatacccgggcaccaggtaatcggtgtagtagaagatgtaggtgagggggtt
gaaggagttaggaggggagagcgtgttggagttccatggctatactatgcttgtggtgaa
tgcaggtattgtagaaggggtctcgagaatctctgtgaaaacgctttattcacaggctac
agtgtggacggcgggtacgctgagtacatggttgcaaaggcaggcttcatacataggata
cctgatggaatagatgacacccatgcagctccattaatgtgtgctggtgcaataggctat
agatccctaaagctaacggggctccttggtaagggtgatgcaaccctgggtctatttggc
tacggtgcagccgcacaccttgttctacaggtggctaggaggcttggcttaagagtatac
gtgttcacgagtaataggtggaagatagagaaggctctcgagaacggtgccgaatgggct
ggctcaacaagtgaggagcccccgcgtagactcgatgccgcaatagtgtatgcacctgtg
tccagtgtcttcattgaggcattgaagaagatagataagggtgggagagtagtattggct
gagatatatatgactccaatcgagcagctggactacagcctcctatggcatgagaaagaa
gttaaaagcgttgcgaatgtaactaggaaggatgtaggagagttcctagaggtagccagt
agacacggtgtgaagcctgaagtgaaaacctataggcttagcgaggccaatgaggcatta
atagagttaaagaagggaggacacttagggcaactagtactagatgtagcttaa

DBGET integrated database retrieval system