KEGG   Desulfurococcus kamchatkensis: DKAM_1133Help
Entry
DKAM_1133         CDS       T00817                                 

Definition
alcohol dehydrogenase, zinc-containing
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
dka  Desulfurococcus kamchatkensis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:dka00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    DKAM_1133
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DKAM_1133
  Lipid metabolism
   00071 Fatty acid degradation
    DKAM_1133
  Amino acid metabolism
   00350 Tyrosine metabolism
    DKAM_1133
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    DKAM_1133
   00626 Naphthalene degradation
    DKAM_1133
Enzymes [BR:dka01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     DKAM_1133
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1065752..1066765)
Genome map
AA seq 337 aa AA seqDB search
MYTLRAMVLYSPAPVESRPLKYMDVEKPSPGRGEVLIRILKCGVCRTDLHIVEGELKPVK
LPLIPGHQVIGVVEDVGEGVEGVRRGERVGVPWLYYACGECRYCRRGLENLCENALFTGY
SVDGGYAEYMVAKAGFIHRIPDGIDDTHAAPLMCAGAIGYRSLKLTGLLGKGDATLGLFG
YGAAAHLVLQVARRLGLRVYVFTSNRWKIEKALENGAEWAGSTSEEPPRRLDAAIVYAPV
SSVFIEALKKIDKGGRVVLAEIYMTPIEQLDYSLLWHEKEVKSVANVTRKDVGEFLEVAS
RHGVKPEVKTYRLSEANEALIELKKGGHLGQLVLDVA
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
gtgtatacgttgagggcgatggttctctattctccagctcctgtcgagtcaaggccgttg
aaatacatggatgtcgagaaaccaagccccggtagaggcgaggtcttgataaggatcctc
aaatgcggcgtgtgtaggacggatctccacattgttgaaggcgagttgaaacctgtaaag
ctcccactgatacccgggcaccaggtaatcggtgtagtagaagatgtaggtgagggggtt
gaaggagttaggaggggagagcgtgttggagttccatggctatactatgcttgtggtgaa
tgcaggtattgtagaaggggtctcgagaatctctgtgaaaacgctttattcacaggctac
agtgtggacggcgggtacgctgagtacatggttgcaaaggcaggcttcatacataggata
cctgatggaatagatgacacccatgcagctccattaatgtgtgctggtgcaataggctat
agatccctaaagctaacggggctccttggtaagggtgatgcaaccctgggtctatttggc
tacggtgcagccgcacaccttgttctacaggtggctaggaggcttggcttaagagtatac
gtgttcacgagtaataggtggaagatagagaaggctctcgagaacggtgccgaatgggct
ggctcaacaagtgaggagcccccgcgtagactcgatgccgcaatagtgtatgcacctgtg
tccagtgtcttcattgaggcattgaagaagatagataagggtgggagagtagtattggct
gagatatatatgactccaatcgagcagctggactacagcctcctatggcatgagaaagaa
gttaaaagcgttgcgaatgtaactaggaaggatgtaggagagttcctagaggtagccagt
agacacggtgtgaagcctgaagtgaaaacctataggcttagcgaggccaatgaggcatta
atagagttaaagaagggaggacacttagggcaactagtactagatgtagcttaa

DBGET integrated database retrieval system