KEGG   Desulfurococcus kamchatkensis: DKAM_1185Help
Entry
DKAM_1185         CDS       T00817                                 

Definition
Pyruvate:ferredoxin oxidoreductase subunit gamma-like protein
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
dka  Desulfurococcus kamchatkensis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dka00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DKAM_1185
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DKAM_1185
   00020 Citrate cycle (TCA cycle)
    DKAM_1185
   00620 Pyruvate metabolism
    DKAM_1185
   00640 Propanoate metabolism
    DKAM_1185
   00650 Butanoate metabolism
    DKAM_1185
  Energy metabolism
   00680 Methane metabolism
    DKAM_1185
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    DKAM_1185
Enzymes [BR:dka01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     DKAM_1185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1105862..1106452
Genome map
AA seq 196 aa AA seqDB search
MYRMLYEILFYGRGGQGAVTAANILVEAAMFEGKHGQGFPFFGAERRGAPVTAFARLSDK
PILRHGMFNEADVIIVLDPGLLDLGVVKRSLLRENGIVVVNTEKDKVLPESINHRGRARI
YRVDATKIARDLGLVIAGWPVVNTSMLGAFVKATGLLTIESVKKAIMNYFEGGKAGELNM
RAAERAYHETKLILEV
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
gtgtatagaatgctatatgagatattattctatgggagaggagggcaaggagctgtaaca
gcagccaatatactagtagaggcagcaatgttcgagggtaaacacggccagggattccca
ttcttcggcgctgagagaagaggcgcccctgtaacagcgttcgccaggttaagcgataag
ccgatacttagacacggaatgtttaatgaggccgacgtgatcatcgtgctggatcctggg
ctactggatctaggggtcgttaagaggagtttactaagagagaacggtatagttgtagtg
aacactgagaaggataaggtgctgccggaaagcattaaccaccgtggcagggcaagaata
tacagggttgatgccacgaagatagctagagacctagggctagttatcgctggatggccc
gtagtcaacacgagcatgctgggcgccttcgtgaaagctacagggctgctcacaattgaa
agcgttaagaaagcgattatgaattattttgaaggtggcaaggctggcgagctcaacatg
agagccgccgagcgtgcttaccatgagaccaaactaattctcgaggtgtag

DBGET integrated database retrieval system