KEGG   Desulfurococcus amylolyticus 1221n: DKAM_1246Help
Entry
DKAM_1246         CDS       T00817                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dka  Desulfurococcus amylolyticus 1221n
Pathway
dka00010  Glycolysis / Gluconeogenesis
dka00051  Fructose and mannose metabolism
dka00562  Inositol phosphate metabolism
dka01100  Metabolic pathways
dka01110  Biosynthesis of secondary metabolites
dka01120  Microbial metabolism in diverse environments
dka01130  Biosynthesis of antibiotics
dka01200  Carbon metabolism
dka01230  Biosynthesis of amino acids
Module
dka_M00002  Glycolysis, core module involving three-carbon compounds
dka_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dka00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DKAM_1246
   00051 Fructose and mannose metabolism
    DKAM_1246
   00562 Inositol phosphate metabolism
    DKAM_1246
Enzymes [BR:dka01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     DKAM_1246
Exosome [BR:dka04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   DKAM_1246
  Exosomal proteins of bladder cancer cells
   DKAM_1246
  Exosomal proteins of melanoma cells
   DKAM_1246
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM ThiG IGPS DHO_dh Neur B12-binding FMN_dh
Motif
Other DBs
NCBI-ProteinID: ACL11572
UniProt: B8D641
Position
complement(1167200..1167895)
Genome map
AA seq 231 aa AA seqDB search
MVKPVLAVNFKAYYPHSFGENAYRLAKDAVRVWRETGVEVILAPPFTELKSVIEAVKDTG
VKVFAQHADPVEPGAITGFIPLEGLKNLGAHGVILNHSEHRLKISDINYLVKKARRLGIE
TLVCADTPETGAAVAVLGPDMVAVEPPELIGTGVSVSKAKPEVVTNSVDMIRRVNKDVAI
LTGAGITTGEDAYIAVKLGTIGVLVASGIVKAKDPYQVMKEMAEAMLKGLA
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggttaagccagtgctagctgtgaattttaaggcctattacccccatagttttggtgaa
aacgcttatagattagcaaaagacgctgtcagggtgtggagagagaccggtgtagaagta
atacttgcaccaccattcaccgagttgaaaagcgttatcgaagccgtgaaagataccggg
gtaaaggtattcgcccagcatgctgacccagtggagcccggggctattacagggtttata
ccattagaggggttgaagaacctgggggcacatggtgtaatactgaaccatagtgagcat
aggctaaaaatctctgatataaactatttggttaagaaggcaaggagactcggcatcgag
acacttgtatgtgcggatacgcctgaaacaggtgctgctgtagcagtactgggaccggac
atggttgccgtagaaccgcccgagctaattggaacaggtgtaagcgtaagcaaggctaag
ccggaggtagtgactaacagtgtagacatgattagacgggtcaataaagacgtagccata
ctaacgggtgctgggataacgactggcgaggacgcctacatagctgtgaaactcggcaca
ataggggtcttagtagcctccgggatagtgaaagcaaaagacccctatcaagtaatgaaa
gaaatggctgaagccatgctcaagggcctcgcctaa

DBGET integrated database retrieval system