KEGG   Desulfurococcus kamchatkensis: DKAM_1246Help
Entry
DKAM_1246         CDS       T00817                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dka  Desulfurococcus kamchatkensis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dka00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DKAM_1246
   01230 Biosynthesis of amino acids
    DKAM_1246
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DKAM_1246
   00051 Fructose and mannose metabolism
    DKAM_1246
   00562 Inositol phosphate metabolism
    DKAM_1246
Enzymes [BR:dka01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     DKAM_1246
Exosome [BR:dka04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   DKAM_1246
  Exosomal proteins of bladder cancer cells
   DKAM_1246
  Exosomal proteins of melanoma cells
   DKAM_1246
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1167200..1167895)
Genome map
AA seq 231 aa AA seqDB search
MVKPVLAVNFKAYYPHSFGENAYRLAKDAVRVWRETGVEVILAPPFTELKSVIEAVKDTG
VKVFAQHADPVEPGAITGFIPLEGLKNLGAHGVILNHSEHRLKISDINYLVKKARRLGIE
TLVCADTPETGAAVAVLGPDMVAVEPPELIGTGVSVSKAKPEVVTNSVDMIRRVNKDVAI
LTGAGITTGEDAYIAVKLGTIGVLVASGIVKAKDPYQVMKEMAEAMLKGLA
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggttaagccagtgctagctgtgaattttaaggcctattacccccatagttttggtgaa
aacgcttatagattagcaaaagacgctgtcagggtgtggagagagaccggtgtagaagta
atacttgcaccaccattcaccgagttgaaaagcgttatcgaagccgtgaaagataccggg
gtaaaggtattcgcccagcatgctgacccagtggagcccggggctattacagggtttata
ccattagaggggttgaagaacctgggggcacatggtgtaatactgaaccatagtgagcat
aggctaaaaatctctgatataaactatttggttaagaaggcaaggagactcggcatcgag
acacttgtatgtgcggatacgcctgaaacaggtgctgctgtagcagtactgggaccggac
atggttgccgtagaaccgcccgagctaattggaacaggtgtaagcgtaagcaaggctaag
ccggaggtagtgactaacagtgtagacatgattagacgggtcaataaagacgtagccata
ctaacgggtgctgggataacgactggcgaggacgcctacatagctgtgaaactcggcaca
ataggggtcttagtagcctccgggatagtgaaagcaaaagacccctatcaagtaatgaaa
gaaatggctgaagccatgctcaagggcctcgcctaa

DBGET integrated database retrieval system