KEGG   Desulfurococcus kamchatkensis: DKAM_1247Help
Entry
DKAM_1247         CDS       T00817                                 

Definition
Fructose-1,6-bisphosphatase
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
dka  Desulfurococcus kamchatkensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dka00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DKAM_1247
   01230 Biosynthesis of amino acids
    DKAM_1247
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DKAM_1247
   00030 Pentose phosphate pathway
    DKAM_1247
   00051 Fructose and mannose metabolism
    DKAM_1247
  Energy metabolism
   00680 Methane metabolism
    DKAM_1247
Enzymes [BR:dka01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     DKAM_1247
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     DKAM_1247
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1167925..1169076)
Genome map
AA seq 383 aa AA seqDB search
MGMKITLSVIKADLGSIAGHHMPHPDQLAAVTKMLAEAKQKGLIVDFYVTHVGDDIQLIM
THTKGPDHPDIHGLAWDAFKAATKVARELKLYAAGQDLLSEAFSGNVKGLGPGVAELEME
EREAEPVITFHADKTEPGAFNLPLFRVFADPFNTAGLVIDPKMHDGFVFEVYDVFEGRSV
LLKSPEEMYDILALIGTPGRYIVRRVYRKSDNLLAAVVSVERLNLIAGRYVGKDDPVAIV
RAQHGLPAVGEVLEAFSFPHLVAGWMRGSHHGPLMPVPMRYARVTRFDGPPRVIALGWNI
SNGKLIGPADLFDDVAFDETRRLAQFIAEYMRRHGPFMPHRLGPEEMEYTTLPLVLEKLK
DRFVKSEEEAKVVKKHSDMLSGS
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgggtatgaagattactctctcagttatcaaggcagacctaggcagtatagcaggccat
cacatgccccatccagatcaattagctgctgtaacaaagatgcttgctgaggcgaagcag
aaggggttaatagtagatttctacgtcacccatgttggagatgatatccagttaataatg
acacatacgaaaggacccgatcacccggatatccatggcttggcctgggatgccttcaag
gcggctacgaaggtagcccgcgagctaaagctctacgcggctggccaggatcttttatca
gaagccttctccggtaacgtgaagggacttggcccaggtgtggctgagcttgaaatggag
gagagggaggctgagccagttataacgtttcacgcggataaaacagagccaggcgcattt
aacctacctttattcagagtgttcgccgatccattcaataccgctgggctcgtaatagat
cccaagatgcatgatggatttgtgttcgaagtatatgatgtattcgaggggagaagcgtt
ttattgaagtcccccgaggaaatgtatgatatactcgcgttgataggtactcctggcaga
tacattgttaggagggtatataggaagagcgataatctactagccgccgttgtcagcgtt
gaaagacttaacctcatagcaggcaggtatgttggtaaagatgacccagttgccatcgtg
agggcgcaacacgggttaccggctgttggcgaggtactggaagcattcagtttcccacac
ctggtagctgggtggatgaggggaagccaccatgggccattgatgcctgtgccaatgagg
tacgctagggtgacaaggtttgatggcccgcctagagtcatagccttaggatggaatatc
tctaatgggaaactaataggaccggctgatctattcgatgacgtagcatttgatgagaca
aggaggttggctcaattcatcgctgagtatatgagaagacatggacccttcatgccccat
agacttggacccgaggagatggagtatacaacgctgccactagtgcttgagaagctaaag
gatagatttgtaaaaagtgaggaagaagccaaggtagtgaagaagcatagtgatatgcta
tccggaagctaa

DBGET integrated database retrieval system