KEGG   Desulfurococcus kamchatkensis: DKAM_1247Help
Entry
DKAM_1247         CDS       T00817                                 

Definition
Fructose-1,6-bisphosphatase
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
dka  Desulfurococcus kamchatkensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:dka01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:dka01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dka00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:dka00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:dka00051]
Metabolism; Energy metabolism; Methane metabolism [PATH:dka00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1167925..1169076)
Genome map
AA seq 383 aa AA seqDB search
MGMKITLSVIKADLGSIAGHHMPHPDQLAAVTKMLAEAKQKGLIVDFYVTHVGDDIQLIM
THTKGPDHPDIHGLAWDAFKAATKVARELKLYAAGQDLLSEAFSGNVKGLGPGVAELEME
EREAEPVITFHADKTEPGAFNLPLFRVFADPFNTAGLVIDPKMHDGFVFEVYDVFEGRSV
LLKSPEEMYDILALIGTPGRYIVRRVYRKSDNLLAAVVSVERLNLIAGRYVGKDDPVAIV
RAQHGLPAVGEVLEAFSFPHLVAGWMRGSHHGPLMPVPMRYARVTRFDGPPRVIALGWNI
SNGKLIGPADLFDDVAFDETRRLAQFIAEYMRRHGPFMPHRLGPEEMEYTTLPLVLEKLK
DRFVKSEEEAKVVKKHSDMLSGS
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgggtatgaagattactctctcagttatcaaggcagacctaggcagtatagcaggccat
cacatgccccatccagatcaattagctgctgtaacaaagatgcttgctgaggcgaagcag
aaggggttaatagtagatttctacgtcacccatgttggagatgatatccagttaataatg
acacatacgaaaggacccgatcacccggatatccatggcttggcctgggatgccttcaag
gcggctacgaaggtagcccgcgagctaaagctctacgcggctggccaggatcttttatca
gaagccttctccggtaacgtgaagggacttggcccaggtgtggctgagcttgaaatggag
gagagggaggctgagccagttataacgtttcacgcggataaaacagagccaggcgcattt
aacctacctttattcagagtgttcgccgatccattcaataccgctgggctcgtaatagat
cccaagatgcatgatggatttgtgttcgaagtatatgatgtattcgaggggagaagcgtt
ttattgaagtcccccgaggaaatgtatgatatactcgcgttgataggtactcctggcaga
tacattgttaggagggtatataggaagagcgataatctactagccgccgttgtcagcgtt
gaaagacttaacctcatagcaggcaggtatgttggtaaagatgacccagttgccatcgtg
agggcgcaacacgggttaccggctgttggcgaggtactggaagcattcagtttcccacac
ctggtagctgggtggatgaggggaagccaccatgggccattgatgcctgtgccaatgagg
tacgctagggtgacaaggtttgatggcccgcctagagtcatagccttaggatggaatatc
tctaatgggaaactaataggaccggctgatctattcgatgacgtagcatttgatgagaca
aggaggttggctcaattcatcgctgagtatatgagaagacatggacccttcatgccccat
agacttggacccgaggagatggagtatacaacgctgccactagtgcttgagaagctaaag
gatagatttgtaaaaagtgaggaagaagccaaggtagtgaagaagcatagtgatatgcta
tccggaagctaa

DBGET integrated database retrieval system