KEGG   Desulfurococcus kamchatkensis: DKAM_1301Help
Entry
DKAM_1301         CDS       T00817                                 

Definition
Threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
dka  Desulfurococcus kamchatkensis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dka00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    DKAM_1301
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DKAM_1301
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    DKAM_1301
Enzymes [BR:dka01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     DKAM_1301
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1217678..1218742)
Genome map
AA seq 354 aa AA seqDB search
MKWKCNHCGFEADAFSEYHWRCPRCGGPLDLVYDGKLEKTSSKNIWEKYGGTIPLKPEKT
RREGNTPLVEEKIDGMTLLFKLEYLNPGGSFKDRGSTLAIYYAYKLGFKNVIEDTSGNTG
ISVALYSRLYNLKTRIYMPKTAPPGKKKVIKALDAEIIEAPTRGDATEMVLKEALTGAYY
VAHTWSYFYIMGASTIAWEVLEEDVPDYVISPIGSGGLFLGLVKGFEKALEAGWITKMPR
FIGVQGYSTQPVYKAFKGVTQPGEDSSLADGIMVPNPPRLNEIVNALHKYQGDVILVGNT
EILRAWRELWELGFLVEPTSASIYAALEKIKNQLSGKKVLLVLTGSGLKNIPDI
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggaagtgtaaccattgcggtttcgaggctgacgcgtttagtgaataccattgg
agatgtcctcgttgtggtggacccctagatcttgtttacgatggtaagcttgagaaaacc
agctcgaagaatatctgggagaaatatggcggtacaatacctttgaaaccagagaagaca
aggagggagggtaacacaccgctagttgaggagaaaatcgatggaatgacacttctcttc
aagcttgaataccttaatccaggcggtagcttcaaggaccggggttcaacactagccata
tactatgcctataaattaggcttcaagaatgttatcgaggataccagcggtaacacaggt
atctcggtagccctctactcaagactctacaatttaaagacaagaatatacatgcctaaa
acagccccaccaggtaaaaagaaggtcatcaaggcgctcgatgcggaaataattgaggcc
cctacgcgaggcgatgcaactgaaatggttttaaaggaggcacttacgggagcatactac
gtggcacatacttggagctacttctatataatgggggcgtccacaatagcctgggaggtt
ctcgaagaggatgtacccgactacgttatatcgccaataggatcaggcggcttattcctt
ggattagtaaaaggattcgagaaggcccttgaagcaggctggataaccaagatgcctaga
ttcataggtgttcaaggctatagcacacaaccagtttataaagcatttaaaggagtcact
cagccaggagaggactcgagtctcgcggatggaataatggttccaaacccgcctagactg
aatgaaatagttaatgcgttgcataaataccagggagacgtcatcctagtcggcaatacc
gaaatactgagggcatggagggaactatgggagcttggattccttgtagaaccaacctct
gcatccatttatgctgcactagaaaagattaagaaccagctttcaggcaagaaagtacta
ctagtattaacaggctcagggctgaaaaacataccagatatctag

DBGET integrated database retrieval system