KEGG   Desulfotomaculum kuznetsovii: Desku_0027Help
Entry
Desku_0027        CDS       T01499                                 

Definition
Recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
dku  Desulfotomaculum kuznetsovii
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:dku00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Desku_0027
DNA repair and recombination proteins [BR:dku03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Desku_0027
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
35219..35821
Genome map
AA seq 200 aa AA seqDB search
MRYLSGPANRLIEELSKLPGIGPKTAQRLAFHLLNAPPEVAHNLARALVFARDNVRYCSV
CANLTDREVCQICSDPERDPTLLCVVQEPRDVVAMEKTRGYRGLYHVLQGAISPLAGVGP
DDLTIKQLLARLGEGKIKEVILATNPDVEGDATALYLAQLIKPLGLKVTRIAHGLPVGAH
LEYADEMTLARALEGRRELT
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
gtgaggtatctttccggccctgcaaaccgcctgattgaggagctgtccaagctgcccggc
atcggtcccaaaacggcccagcgcctggccttccaccttttgaacgctccgccggaagta
gcccacaacctggcccgggcgctggttttcgcccgcgataacgtccgctattgttcggtc
tgcgccaacctcaccgaccgggaggtctgccagatttgctccgacccggagcgggacccc
acccttctctgcgtggtccaggagccgcgggacgtggtggctatggaaaaaacccggggc
taccgggggctctaccacgtcctccagggggccatctcccccctggccggggttggtccg
gacgacctgaccatcaagcagcttctggccaggttgggcgaaggaaagatcaaagaggta
attctggccaccaatccggacgttgaaggtgatgccaccgccctttaccttgcccagcta
atcaaacccctgggtttgaaggttacccgcattgcccacggtttgcccgtgggcgcccac
ctggaatatgccgatgagatgaccctggccagggccctggaaggtcgccgggaattaaca
taa

DBGET integrated database retrieval system