KEGG   Desulfotomaculum kuznetsovii: Desku_0219Help
Entry
Desku_0219        CDS       T01499                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
dku  Desulfotomaculum kuznetsovii
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:dku00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
232654..233868
Genome map
AA seq 404 aa AA seqDB search
MPVQVRNIEIKNRAQALEEIAAVGADQAGCRLMAPKAVHRVLKISGLTPVQANILKQEML
AKGGEAAVARGVVEHAVDKTDVLLMGTLKQFDALLAKLKLQPFGLAALAEEIRRVLQHLE
GRPARRLSCRGKELVLGERTLVMGILNVTPDSFSDGGRFSDPSRAVEHAHRLVEDGADII
DLGGESTRPGHTPVTAEEEMRRVIPVLEKLVQEISVPISVDTTKAAVAREALEIGAHIIN
DQWALRADPEMAAVVARYDAPVILMHNQKGTEYKDLMGDIIRFFRESIALALEAGISPEK
IIIDPGIGFGKTVEQNLEVMNRLSELACLGLPVLLGTSRKSMIGKTLDLPVDQRVEGTAA
TVAVGIAAGVDIVRVHDVREMVRVARMTDAMVRRKPARCACGEE
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
ttgcccgtacaggtacggaatattgaaataaaaaaccgggcccaggccctggaggaaata
gctgcagtgggggcggaccaggccggctgccggttgatggcccccaaggcggtccaccgg
gttttaaagatcagcggcctgaccccggtccaggccaacattctcaagcaggaaatgctg
gctaaaggtggggaggcggccgtggcccggggggtagtcgaacatgcggtggacaaaacc
gatgtgctgctcatgggcaccctgaagcagtttgacgccctgctggccaagctcaagctc
cagcccttcggcctcgctgccctggcggaggagatccgccgcgtcctgcagcacctggag
ggccggcccgccagaaggctgagctgccggggaaaggaactggtgctgggggaaaggacc
ctggtcatgggcatactcaacgtaacccccgattccttttccgacggcggcaggttcagc
gatccatcgcgggcggtggagcatgcccaccggctggtggaggacggggctgatattatc
gatctgggcggggaatccacccggccggggcacacgccggtaacggcggaggaagaaatg
cgccgggtaatcccggttctggaaaagctggtgcaggagatctccgtgcccatatccgtt
gataccaccaaggccgcggtggcccgggaggccctggaaattggcgcccacatcatcaac
gaccagtgggccctgcgggccgatcctgaaatggcggcggtggtggcccgctacgatgcc
cccgtgatcctcatgcacaaccagaagggtacggagtataaggacctgatgggggatatc
atccgcttcttccgggaaagcatcgccctggccctggaggctggcataagccctgaaaaa
atcattatcgacccggggattggttttggcaaaaccgtggagcaaaacctggaggttatg
aaccggctttccgaactggcctgcctggggctgccggtgctgctggggacatcccggaag
tcaatgatcggcaagactttggacctgcccgtggaccagcgggtggagggtacggcggcc
acggtggccgttggcattgccgccggggtggacatcgtccgggtgcacgatgtcagggaa
atggtgcgggtggcccgcatgaccgacgccatggtgcgccgaaagcccgcgcgctgtgcc
tgcggggaagaataa

DBGET integrated database retrieval system