KEGG   Desulfotomaculum kuznetsovii: Desku_0430Help
Entry
Desku_0430        CDS       T01499                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
dku  Desulfotomaculum kuznetsovii
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:dku00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Desku_0430
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Desku_0430
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Desku_0430
Enzymes [BR:dku01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Desku_0430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
450327..451451
Genome map
AA seq 374 aa AA seqDB search
MAGERDFRHIKRVVVKVGSSSIIYPTGRPNLSQMEQLARQLADLHNQGKEVLLVTSGAIG
VGQHRLGYTRRPRTIPEKQAAAAVGQGMLMHMYDKFFGEYGVAVGQILLTREDFSDRKRF
LNARNTMYTLLRQGVVPVINENDTVAVEEIKLGDNDNLAALVATLVDAELLILLSDIDGL
YDADPRKNSGARLIAEVHEITPELEALSGGAGTPVGTGGIVTKLQAARIAMHSGIVTVLA
SSSEKDVVRRVVAGEPLGTVFWPCSRLEKKKCWIAYSSTVHGRIYVDEGAARALLENGKS
LLPSGIIRVEGSFEMGNTVSICDPAGKEIARGIVNYSSAEVERIKGIQTREIARVLGHKD
YDEVVHRNNLVLDI
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atggccggggaaagggatttccgccatatcaaacgggttgtggtcaaggtgggttccagt
tccattatctatcccaccgggcggcccaacctttcccagatggaacagctggcgcgtcaa
ctggcggatttacataaccagggcaaagaagtgctcctggtcacttcgggagccattggg
gtgggacagcaccggttgggctacacccgccgtcccaggaccattccggaaaagcaggcc
gccgcagcggtgggccagggtatgcttatgcatatgtacgataagttctttggcgaatac
ggtgttgccgtgggccaaatcctcctgacccgggaggatttcagcgaccgcaagcgcttt
ttaaacgcccgcaacaccatgtatacccttttgcgccagggcgtggtacccgtgattaat
gaaaacgatacggtggcggtggaggaaataaagctgggggataacgataacctggcggcc
ctggtggccaccctggtggatgccgagttgctgattcttttatcggatatagacggcctt
tacgatgccgatccccgcaaaaacagcggggccaggctaattgcggaagtgcacgaaatc
acgccggaactggaagcactttccggaggggcggggacgccggtgggtaccggcggcatt
gttaccaaactccaggcggcgcgcattgccatgcactcggggatcgttaccgtgctggcc
agttcttccgaaaaggatgtggtcaggcgggtggtggccggcgaacccctgggcacggta
ttctggccctgcagccggctggagaaaaaaaagtgctggatcgcctatagctccaccgtg
cacggccgcatctacgtggatgaaggagcggcgcgggcgctgctggaaaacggcaagagc
cttttgccttcggggatcatccgggtggaaggatcctttgagatgggcaacaccgtgagt
atctgcgatcctgcaggtaaagaaattgcccggggtatagtgaactactcctccgccgaa
gtggaacgcatcaagggtatacagaccagggaaattgccagggtactggggcataaggac
tacgacgaggtggtccaccgcaacaacctggtgctggatatttaa

DBGET integrated database retrieval system