KEGG   Desulfotomaculum kuznetsovii: Desku_0430Help
Entry
Desku_0430        CDS       T01499                                 

Definition
(GenBank) Glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
dku  Desulfotomaculum kuznetsovii
Pathway
dku00330  Arginine and proline metabolism
dku00332  Carbapenem biosynthesis
dku01100  Metabolic pathways
dku01130  Biosynthesis of antibiotics
dku01230  Biosynthesis of amino acids
Module
dku_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:dku00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Desku_0430
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Desku_0430
Enzymes [BR:dku01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Desku_0430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: AEG14054
JGI: Desku_0430
UniProt: F6CQD1
Position
450327..451451
Genome map
AA seq 374 aa AA seqDB search
MAGERDFRHIKRVVVKVGSSSIIYPTGRPNLSQMEQLARQLADLHNQGKEVLLVTSGAIG
VGQHRLGYTRRPRTIPEKQAAAAVGQGMLMHMYDKFFGEYGVAVGQILLTREDFSDRKRF
LNARNTMYTLLRQGVVPVINENDTVAVEEIKLGDNDNLAALVATLVDAELLILLSDIDGL
YDADPRKNSGARLIAEVHEITPELEALSGGAGTPVGTGGIVTKLQAARIAMHSGIVTVLA
SSSEKDVVRRVVAGEPLGTVFWPCSRLEKKKCWIAYSSTVHGRIYVDEGAARALLENGKS
LLPSGIIRVEGSFEMGNTVSICDPAGKEIARGIVNYSSAEVERIKGIQTREIARVLGHKD
YDEVVHRNNLVLDI
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atggccggggaaagggatttccgccatatcaaacgggttgtggtcaaggtgggttccagt
tccattatctatcccaccgggcggcccaacctttcccagatggaacagctggcgcgtcaa
ctggcggatttacataaccagggcaaagaagtgctcctggtcacttcgggagccattggg
gtgggacagcaccggttgggctacacccgccgtcccaggaccattccggaaaagcaggcc
gccgcagcggtgggccagggtatgcttatgcatatgtacgataagttctttggcgaatac
ggtgttgccgtgggccaaatcctcctgacccgggaggatttcagcgaccgcaagcgcttt
ttaaacgcccgcaacaccatgtatacccttttgcgccagggcgtggtacccgtgattaat
gaaaacgatacggtggcggtggaggaaataaagctgggggataacgataacctggcggcc
ctggtggccaccctggtggatgccgagttgctgattcttttatcggatatagacggcctt
tacgatgccgatccccgcaaaaacagcggggccaggctaattgcggaagtgcacgaaatc
acgccggaactggaagcactttccggaggggcggggacgccggtgggtaccggcggcatt
gttaccaaactccaggcggcgcgcattgccatgcactcggggatcgttaccgtgctggcc
agttcttccgaaaaggatgtggtcaggcgggtggtggccggcgaacccctgggcacggta
ttctggccctgcagccggctggagaaaaaaaagtgctggatcgcctatagctccaccgtg
cacggccgcatctacgtggatgaaggagcggcgcgggcgctgctggaaaacggcaagagc
cttttgccttcggggatcatccgggtggaaggatcctttgagatgggcaacaccgtgagt
atctgcgatcctgcaggtaaagaaattgcccggggtatagtgaactactcctccgccgaa
gtggaacgcatcaagggtatacagaccagggaaattgccagggtactggggcataaggac
tacgacgaggtggtccaccgcaacaacctggtgctggatatttaa

DBGET integrated database retrieval system