KEGG   Desulfotomaculum kuznetsovii: Desku_0616Help
Entry
Desku_0616        CDS       T01499                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
dku  Desulfotomaculum kuznetsovii
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:dku00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Desku_0616
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Desku_0616
   00650 Butanoate metabolism
    Desku_0616
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Desku_0616
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Desku_0616
   00622 Xylene degradation
    Desku_0616
   00621 Dioxin degradation
    Desku_0616
Enzymes [BR:dku01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Desku_0616
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
650652..651548
Genome map
AA seq 298 aa AA seqDB search
MEKIKAAIVGPGNIGTDLMYKLLRSKYVEVTMMVGIYPESEGLARARSLGIKASHEGIDA
VLREPEIKIVFDATGAKPHLKHAPLLREAGKIAIDLTPAAVGPYVVPVVNIDQHLDAMNV
NMVTCGGQATVPIVAAINRVAGVQYAEIVSSISSKSAGPGTRQNIDEFTETTARALEVVG
GAQKGKAIIILNPAEPPIMMHNTIYTLVEHPDEDKIRAAVLDMVRRIQEYVPGYRLRVEP
LVEGNKVTTIIEVTGAGDFLPTYAGNLDIMTSAAARVGELMAMRLLGIYSRKDVESCA
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaaaataaaggcagccatcgtcgggccgggtaacatcggtaccgacctgatgtac
aaactgttgcgcagcaaatacgtggaagtaaccatgatggtgggaatttacccggaatcc
gagggcctggcccgggccagatcactgggtattaaagcctcacacgaagggatcgacgca
gtactgcgggaaccggagatcaagattgtctttgatgctaccggagccaagcctcatctt
aaacatgctcccctgctgcgggaggcgggcaagattgccatcgacctcactccggcggcg
gtgggtccttacgtagtcccggtagttaacatagatcagcatctggacgccatgaacgta
aacatggttacctgtggtggccaggccaccgtgcccatcgtggcggcaattaaccgggtg
gcaggcgttcaatacgcagagatcgtttcttccatttcaagtaaaagcgccgggccggga
acccgccagaacatcgatgagtttactgagaccacggccagggccctggaagtggtgggc
ggggctcaaaagggcaaggccattattatccttaacccagccgagcccccaatcatgatg
cataacaccatctacactctggtggagcatccggatgaggataaaattcgcgctgcagtg
ctcgacatggtacggcgcattcaggagtacgttcccggttaccggctccgggtagagccg
ctggtggaaggaaacaaggtgactaccatcatcgaagtgaccggggcgggggacttcctg
cccacttatgcgggcaacctggacattatgacttcggctgctgcacgggtgggcgagttg
atggccatgcgcctgctggggatttacagtcggaaggatgtggaaagctgtgcctaa

DBGET integrated database retrieval system