KEGG   Desulfotomaculum kuznetsovii: Desku_0616Help
Entry
Desku_0616        CDS       T01499                                 

Definition
(GenBank) Acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
dku  Desulfotomaculum kuznetsovii
Pathway
dku00360  Phenylalanine metabolism
dku00362  Benzoate degradation
dku00620  Pyruvate metabolism
dku00621  Dioxin degradation
dku00622  Xylene degradation
dku00650  Butanoate metabolism
dku01100  Metabolic pathways
dku01120  Microbial metabolism in diverse environments
dku01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:dku00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Desku_0616
   00650 Butanoate metabolism
    Desku_0616
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Desku_0616
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Desku_0616
   00622 Xylene degradation
    Desku_0616
   00621 Dioxin degradation
    Desku_0616
Enzymes [BR:dku01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Desku_0616
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA NAD_binding_3 Peptidase_A25
Motif
Other DBs
NCBI-ProteinID: AEG14227
JGI: Desku_0616
UniProt: F6CPD6
Position
650652..651548
Genome map
AA seq 298 aa AA seqDB search
MEKIKAAIVGPGNIGTDLMYKLLRSKYVEVTMMVGIYPESEGLARARSLGIKASHEGIDA
VLREPEIKIVFDATGAKPHLKHAPLLREAGKIAIDLTPAAVGPYVVPVVNIDQHLDAMNV
NMVTCGGQATVPIVAAINRVAGVQYAEIVSSISSKSAGPGTRQNIDEFTETTARALEVVG
GAQKGKAIIILNPAEPPIMMHNTIYTLVEHPDEDKIRAAVLDMVRRIQEYVPGYRLRVEP
LVEGNKVTTIIEVTGAGDFLPTYAGNLDIMTSAAARVGELMAMRLLGIYSRKDVESCA
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaaaataaaggcagccatcgtcgggccgggtaacatcggtaccgacctgatgtac
aaactgttgcgcagcaaatacgtggaagtaaccatgatggtgggaatttacccggaatcc
gagggcctggcccgggccagatcactgggtattaaagcctcacacgaagggatcgacgca
gtactgcgggaaccggagatcaagattgtctttgatgctaccggagccaagcctcatctt
aaacatgctcccctgctgcgggaggcgggcaagattgccatcgacctcactccggcggcg
gtgggtccttacgtagtcccggtagttaacatagatcagcatctggacgccatgaacgta
aacatggttacctgtggtggccaggccaccgtgcccatcgtggcggcaattaaccgggtg
gcaggcgttcaatacgcagagatcgtttcttccatttcaagtaaaagcgccgggccggga
acccgccagaacatcgatgagtttactgagaccacggccagggccctggaagtggtgggc
ggggctcaaaagggcaaggccattattatccttaacccagccgagcccccaatcatgatg
cataacaccatctacactctggtggagcatccggatgaggataaaattcgcgctgcagtg
ctcgacatggtacggcgcattcaggagtacgttcccggttaccggctccgggtagagccg
ctggtggaaggaaacaaggtgactaccatcatcgaagtgaccggggcgggggacttcctg
cccacttatgcgggcaacctggacattatgacttcggctgctgcacgggtgggcgagttg
atggccatgcgcctgctggggatttacagtcggaaggatgtggaaagctgtgcctaa

DBGET integrated database retrieval system