KEGG   Desulfotomaculum kuznetsovii: Desku_0616Help
Entry
Desku_0616        CDS       T01499                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
dku  Desulfotomaculum kuznetsovii
Pathway
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:dku00620]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:dku00650]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:dku00362]
Metabolism; Xenobiotics biodegradation and metabolism; Xylene degradation [PATH:dku00622]
Metabolism; Xenobiotics biodegradation and metabolism; Dioxin degradation [PATH:dku00621]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
650652..651548
Genome map
AA seq 298 aa AA seqDB search
MEKIKAAIVGPGNIGTDLMYKLLRSKYVEVTMMVGIYPESEGLARARSLGIKASHEGIDA
VLREPEIKIVFDATGAKPHLKHAPLLREAGKIAIDLTPAAVGPYVVPVVNIDQHLDAMNV
NMVTCGGQATVPIVAAINRVAGVQYAEIVSSISSKSAGPGTRQNIDEFTETTARALEVVG
GAQKGKAIIILNPAEPPIMMHNTIYTLVEHPDEDKIRAAVLDMVRRIQEYVPGYRLRVEP
LVEGNKVTTIIEVTGAGDFLPTYAGNLDIMTSAAARVGELMAMRLLGIYSRKDVESCA
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaaaataaaggcagccatcgtcgggccgggtaacatcggtaccgacctgatgtac
aaactgttgcgcagcaaatacgtggaagtaaccatgatggtgggaatttacccggaatcc
gagggcctggcccgggccagatcactgggtattaaagcctcacacgaagggatcgacgca
gtactgcgggaaccggagatcaagattgtctttgatgctaccggagccaagcctcatctt
aaacatgctcccctgctgcgggaggcgggcaagattgccatcgacctcactccggcggcg
gtgggtccttacgtagtcccggtagttaacatagatcagcatctggacgccatgaacgta
aacatggttacctgtggtggccaggccaccgtgcccatcgtggcggcaattaaccgggtg
gcaggcgttcaatacgcagagatcgtttcttccatttcaagtaaaagcgccgggccggga
acccgccagaacatcgatgagtttactgagaccacggccagggccctggaagtggtgggc
ggggctcaaaagggcaaggccattattatccttaacccagccgagcccccaatcatgatg
cataacaccatctacactctggtggagcatccggatgaggataaaattcgcgctgcagtg
ctcgacatggtacggcgcattcaggagtacgttcccggttaccggctccgggtagagccg
ctggtggaaggaaacaaggtgactaccatcatcgaagtgaccggggcgggggacttcctg
cccacttatgcgggcaacctggacattatgacttcggctgctgcacgggtgggcgagttg
atggccatgcgcctgctggggatttacagtcggaaggatgtggaaagctgtgcctaa

DBGET integrated database retrieval system