KEGG   Desulfotomaculum kuznetsovii: Desku_0666Help
Entry
Desku_0666        CDS       T01499                                 

Definition
(GenBank) Holliday junction ATP-dependent DNA helicase ruvA
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
dku  Desulfotomaculum kuznetsovii
Pathway
dku03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:dku00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Desku_0666
Enzymes [BR:dku01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Desku_0666
DNA repair and recombination proteins [BR:dku03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Desku_0666
    RecFOR pathway proteins
     Desku_0666
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvA_N HHH_5 RuvA_C HHH Transposase_20 DUF3173 HHH_8 5_3_exonuc HHH_3 IMS_HHH
Motif
Other DBs
NCBI-ProteinID: AEG14275
JGI: Desku_0666
UniProt: F6CPE5
Position
710719..711333
Genome map
AA seq 204 aa AA seqDB search
MIAFLSGNLLEIQEDGIIVDVHGVGYLVRVPLSMVSLLPPKGQPVRLHTHLIWREDGPAL
FGFSSRVELETFRSLLNVAGVGPRAALAILSTVTPGTLRRAVVEENENILTAVPGIGKKT
ARRIILELKDKLADMVFEADGTDDTGETGTPGNEGEAVAALVALGYAQMEARRAVRQVRQ
QAASGSTEELLRSALQWLGRQKNA
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgattgcctttctcagtggtaatctgttggaaatacaggaggatggcattattgtggat
gtccatggggtagggtacctggtgcgggtacccctatccatggtgagccttctaccgcca
aaagggcagccggtgcgcctgcatacccatttaatctggcgggaagacgggccggccctc
tttggtttttccagccgggtggagctggaaacctttcgcagtctgttaaatgtggccgga
gtaggcccccgggcggccctggctattctctctacggtaacccccggcactttgcgccgg
gcggtggtggaggaaaatgaaaacattcttacagccgttcccgggataggcaaaaaaacg
gcccggcgcattatcctggagttgaaggacaagctggcagacatggttttcgaggctgac
ggtacagatgatacaggtgaaacaggtactccggggaacgagggggaagccgtagctgcc
ctggtggctttgggttacgcccagatggaggcccgccgggccgtgcggcaggtccgccag
caggccgcttccggttctaccgaagagttgctgcggtccgccctccagtggctgggccgg
caaaaaaacgcttga

DBGET integrated database retrieval system