KEGG   Desulfotomaculum kuznetsovii: Desku_1004Help
Entry
Desku_1004        CDS       T01499                                 

Definition
hypothetical protein
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
dku  Desulfotomaculum kuznetsovii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dku00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Desku_1004
   01230 Biosynthesis of amino acids
    Desku_1004
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desku_1004
   00030 Pentose phosphate pathway
    Desku_1004
   00051 Fructose and mannose metabolism
    Desku_1004
  Energy metabolism
   00680 Methane metabolism
    Desku_1004
Enzymes [BR:dku01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Desku_1004
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Desku_1004
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1032960..1034054)
Genome map
AA seq 364 aa AA seqDB search
MGKKITVTVIKADVGGCVGHSSVHSALIEKAQGMLKGSSLLIDSYVAHVGDDINLIMTHE
LGRNNGEIHQLAWDTFVACTEIAKKLKLYGAGQDLLADAFSGNIKGLGPGVAEMEFEERK
SEPIIIFMADKTEPGAWNLPLYKIFADPFNTAGLVIDPSMHDGFIFEVRDLIENTRVNFS
APEEIYDMLVFIGAPGRYCIKRVFHKKTGEIAAVSSTQRLNLMAGRYVGKDDPVCIVRCQ
SGMPAVGEVLEPFTKPHLVSGWMRGSHSGPLMPVSMQQATPSRFDGPPRVVALGFQLAEG
KLIGPQDFFADPAFDQARQMANEIASYMRSLGPFEPHRLHLDEMEYTTMPQVLKKLKDRF
EKLR
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagaaaattaccgttacggtcatcaaagcggacgttggaggctgtgtgggacat
tcaagcgtccactccgccctgattgaaaaggcccagggcatgcttaagggtagttccctc
ctgatagactcatatgtagcccatgtaggcgacgatattaacctgattatgacccacgaa
ctgggccggaataacggtgaaatccaccagctggcctgggatacttttgtagcctgtact
gaaatagccaagaaactgaagctttacggcgcgggacaggacctgctggctgacgccttt
tccggcaacatcaagggcctgggccctggagtagcggagatggagtttgaagagcgcaag
agcgaacccataataatctttatggccgacaagaccgaaccgggagcctggaacctgccc
ctgtacaaaatttttgccgatccctttaacaccgccgggctggtcatcgatcccagcatg
cacgacgggttcattttcgaggtacgggacctgattgaaaacacgcgggttaacttctca
gcccccgaggaaatatacgatatgctggtattcattggcgctcccggccgctactgcatc
aagcgcgtcttccacaagaaaacgggggaaattgccgccgtgtccagcacccagcggtta
aatctgatggccggtcgctacgtgggcaaggacgacccggtttgcatcgtacgctgccag
agcggcatgccggcagtgggggaggtgctggaacccttcacgaaaccccacctggtcagc
ggctggatgcgcggctcccacagcggcccgctgatgccggttagcatgcagcaggccacc
ccatcccgttttgacggcccgccccgggtggtcgcccttggcttccagttagccgaaggc
aagctcattggtccccaggacttctttgccgacccggcctttgatcaggcccggcaaatg
gccaacgaaattgccagctacatgcgcagtctgggaccctttgaaccccaccggctgcac
ctggacgaaatggaatacaccactatgccccaggtattgaaaaagttaaaagatcgtttt
gaaaagctccggtaa

DBGET integrated database retrieval system