KEGG   Desulfotomaculum kuznetsovii: Desku_1150Help
Entry
Desku_1150        CDS       T01499                                 

Definition
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
dku  Desulfotomaculum kuznetsovii
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:dku00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Desku_1150
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Desku_1150
Enzymes [BR:dku01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Desku_1150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1164503..1165981
Genome map
AA seq 492 aa AA seqDB search
MLFSELIEGQSCLAVGGNQQVHIAGIAYDSRQVQPGFLFVAVEGFTTDGHRYVEQAVSRG
AVAVVVQKEIPLPSGIAFARVPDTRLVLALLAARFYGYPSRKIKLIGVTGTNGKTTTTHL
LAAIYRAAGNKVGLIGTIANWIGDRVLPVSHTTPESLDLQKLLAEMVNDGVAVAVMEVSS
HALALNRVAGCAFDAGVFTNITQDHLDFHRDMEDYLAAKTLLFRGLGQDGKPGLAVINVD
DPRAERIAAATKVPVYTYGLSAEAQVRAQEVKVTPRGASFTVTGSWGECPVNLKLTGYFN
VYNALAALTAAVAGGVPLPLAVRALESVEGVPGRFELVDRGQDFAVVVDYAHTPDGLENI
LTTARAITRGRLITVFGCGGDRDPTKRPLMGEIAARLSDLPVITSDNPRTEDPMRIIAQV
EEGVRRVRSDYRVVPDRRKAIRFALGVAAPGDTVIIAGKGHENYQIIGTTKYPFDDRNEA
IKALDELLNRHP
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
ttgctgtttagcgagttgatcgaggggcaaagctgtctggctgtgggaggcaatcaacag
gtacatatagcgggcattgcctacgactcgcggcaggtgcagccgggttttctgtttgtt
gccgtggagggtttcaccaccgatggccatcgttatgtggagcaggcggtatccaggggt
gcagtagccgtggtggtgcaaaaggaaatcccccttccttccggtattgccttcgcgcgg
gtgcccgacacccgcctggttctggctttgctggccgcgcgtttctatggctatccgtcc
cggaaaataaaattgatcggggttaccgggacaaacggtaaaaccactaccacccatttg
ctggcagccatttaccgggcggcgggaaataaggtgggacttataggtaccattgccaac
tggattggtgaccgggtattgccggtatcccacactacccccgaatctttggacctgcaa
aagttgctggccgaaatggtaaatgatggggttgcggtggcggtgatggaggtaagttcc
catgccctggctttaaaccgggtggccggatgtgcctttgatgccggggtgtttacgaat
attacccaggaccacctggatttccaccgggacatggaggattacctggcggcaaagacg
ctgttgttccggggactgggccaggacggcaagcccggcctggcggtcattaacgtcgat
gatccccgggcggaaaggatcgcggccgcaacaaaagtacccgtttatacctacggactt
tcggcggaagcgcaggtgcgggcccaggaggttaaagttaccccccggggcgcttctttt
accgtcaccggctcctggggagaatgcccggtaaacttaaagttaaccggttatttcaac
gtttataacgccctggccgctctcacggcggcagtggccggaggagttcccctgccactg
gcggttcgggccctggagtcggtggaaggtgtgccgggtcgctttgaactggtagaccgg
gggcaggactttgccgtagtggtggactacgcccatacccccgacgggctggaaaacatc
cttaccaccgcccgggccataaccaggggcaggttgattaccgtgtttggctgtggcggt
gaccgggatcccaccaagcggcccctcatgggggagattgccgcgcgcctgagtgatctt
ccggtgattacttcggataacccccgcaccgaagatcccatgaggattattgcccaggta
gaagaaggggtgcggcgggttcgttccgactaccgggtggtgcccgaccggcggaaggcc
attcgctttgccctgggggttgccgccccgggggatacggtcattatcgccggtaaaggg
catgagaattatcaaattatcggtacaactaaatatccttttgatgatcgcaatgaagct
attaaagcattggacgaacttttaaatagacacccatga

DBGET integrated database retrieval system