KEGG   Desulfotomaculum kuznetsovii: Desku_1226Help
Entry
Desku_1226        CDS       T01499                                 

Definition
(RefSeq) acetate--CoA ligase (EC:6.2.1.1)
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
dku  Desulfotomaculum kuznetsovii
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dku00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Desku_1226
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desku_1226
   00620 Pyruvate metabolism
    Desku_1226
   00640 Propanoate metabolism
    Desku_1226
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Desku_1226
   00680 Methane metabolism
    Desku_1226
Enzymes [BR:dku01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Desku_1226
Lipid biosynthesis proteins [BR:dku01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Desku_1226
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1241827..1243800
Genome map
AA seq 657 aa AA seqDB search
MVEVKPEELKMIKESKLYYPDPEKVKKSVLGSVDAFNALLRKSWEDPESFWADVASELYW
IKPWEKVMGGKMPYFKFFVGGITNPCYNLIDRHLEQGADNKLALIWEGEDYQTKFYTYRM
LYSEVCKFANVLKGFGLQKGDRVAIFLPNLAETVIAVLACYRLGVLFNTVFSGFSVRALR
DRLINYEPQVIVTADGGYRRGREVPLKSKVDEAIEGMESIQAVVVVKRTGSGINMKEGRD
YWWHELMAGAHLECPPEPMEANEPGLVFYTSGTTGKPKGIVHSSVAFVVNNYVYAKFHMD
HHPNDMFWCTADIGWLTMHIWGIAGALSNGVTTIFYEGALDYPRPDRFYQIIDKYRVNKL
FTAPTAIRMLMRYGESWMESYDISCLDVLSLVGEPFNPEAWHWAFEKLGQKRMYINNTWG
QTETAGCPLAGAAWVTPMKPGSCGIQFLGAQLDVVDEDGKPVPPETPGNLIITRPIPMMV
RTLWREPERHIREYFSQVEGCYFTNDAAIKDRDGHFWVTGRIDDVFNVAGHRLSTMEMES
AIIECEGVAEAAVIGVPDPIKGLIPVAFVTLRQGYEAGPEMEQAIKDKVVENIGKIAIPG
TIYFTPVMPKTPSGKIMRRLLKEIVVGGEIKGDITGLEDIGTVEQVKAIVAAKKARG
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atggtagaagtaaaacccgaagagttaaaaatgattaaggagagcaaactttactatccg
gatcccgaaaaagtaaaaaagtcagttctgggcagtgtggacgcctttaatgccttgctt
cgcaaatcatgggaggatccggaaagtttttgggccgatgtagccagtgagctttactgg
attaaaccctgggaaaaagtcatgggaggtaaaatgccttattttaaatttttcgtgggg
ggtataaccaacccctgctacaacctcatcgaccggcatctggagcagggtgccgataac
aagctggccctgatctgggagggggaagactatcagaccaaattttatacttaccggatg
ctttatagcgaagtgtgcaaatttgccaatgttttaaagggttttggtttgcaaaaaggg
gatcgggtggccattttcctgcccaacctggccgaaacggtaatagccgtattggcctgc
taccgcctgggggtgctgtttaataccgttttctccggtttttccgtgcgtgccctgcgg
gaccggttgattaactatgaaccccaggtaattgtcaccgccgacggtggttaccgtcgc
ggccgggaagttcctttaaagtccaaggtggacgaagcaatcgagggtatggaaagcatc
caggccgtggtggtggtcaaacgcacaggttccgggattaacatgaaagaaggacgggac
tactggtggcatgaattaatggccggggcccacctggaatgtccgccggagcccatggag
gccaatgaaccgggactggtgttttacaccagcggtaccaccggcaaacctaaaggtata
gtgcattcaagcgtggccttcgtggtaaacaattatgtttacgctaagttccacatggac
catcaccccaacgatatgttctggtgtacggccgacatcggctggctgaccatgcatatc
tgggggattgcgggcgccctgtccaacggggtgactaccatattttacgagggggccctg
gattacccgcgccccgaccggttctaccagatcattgacaagtaccgggtgaataaacta
tttaccgcacccaccgccatccgcatgctcatgcggtacggggaaagctggatggaatct
tacgatatttcatgcctggatgttctctccctggtgggggaaccgtttaacccggaagcc
tggcactgggcctttgaaaagctgggccaaaagcgcatgtacatcaataacacctggggt
cagacggaaaccgccggttgccccctggccggagcagcctgggtaacccccatgaaaccc
ggttcgtgtggcatccagtttctgggcgcccagctggatgtggtggatgaggatggcaaa
cccgttccccctgaaacgcccggcaacctcatcatcacccgccccatccccatgatggtt
cggaccctttggagagagccagaaaggcatatccgggagtacttcagccaggtggaaggc
tgttattttaccaatgatgccgccatcaaggatagggacggacacttctgggttaccggc
cggattgacgacgtctttaacgtggccggtcaccgcctttccaccatggagatggagagt
gccattattgagtgtgagggggtggccgaagcggcggtgattggtgttccagatcctatt
aaaggattaatccccgtagcctttgtcaccctccggcagggttatgaagccggtcctgaa
atggaacaggccattaaagacaaggtggttgaaaacattggtaaaattgccattcccggt
accatttactttaccccggtaatgcccaaaacccccagcggcaagatcatgcgccggcta
ctcaaggaaattgtcgtcgggggggaaataaagggagatatcaccggtcttgaagatatt
ggcactgtggagcaggtaaaggccatagtggcagccaaaaaggcacgggggtaa

DBGET integrated database retrieval system