KEGG   Desulfotomaculum kuznetsovii: Desku_1246Help
Entry
Desku_1246        CDS       T01499                                 

Definition
GTP cyclohydrolase-2
Orthology
K14652  
3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
dku  Desulfotomaculum kuznetsovii
Pathway
Riboflavin metabolism
Metabolic pathways
Module
Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Class
Metabolism; Metabolism of cofactors and vitamins; Riboflavin metabolism [PATH:dku00740]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1261400..1262617
Genome map
AA seq 405 aa AA seqDB search
MEFRFNTVEEAIEDIRQGKMVVVVDDEDRENEGDVIMAAEKVTPEAVNFMATHARGLICM
PITNERADELDLPLMVTHNTDKHGTAFTVSVDHKDTSTGISAYERAQTIKAILDPATRPE
DLRRPGHIFPLRAREGGVLRRAGHTEAAVDLARLAGLYPAGVICEVMKEDGTMARVPELM
AFCRQHGLKIITIADLIKYRRRTEKLVRRVDSAHLPTKYGDFTAVAYESLLDGKGHLALV
KGDLSQVEAPLVRVHSECLTGDVLGSTRCDCGDQLARAMQMIAKEGVGVLLYMRQEGRGI
GLLNKIRAYKLQDQGKDTVEANEALGFPPDLRDYGIGAQILADLGLKKIRLLTNNPRKIA
GLEGYGLEVVARIPIEVCPSKYNRFYLATKRKKLGHLLSIADEVS
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggaatttcgtttcaacaccgtagaagaagccatcgaggatattcgccagggcaaaatg
gtggtggttgtggatgatgaggaccgggaaaatgaaggggatgtgatcatggcggcagaa
aaggtcactcctgaggcggttaactttatggctacccatgcccgggggttgatctgcatg
cccataaccaatgagcgggcggatgaactggatctgccccttatggtcacccataatacc
gataaacacggtaccgcttttaccgtgtccgtggatcataaagataccagtacgggtatt
tctgcctacgagcgggcacagaccatcaaagccattttagatccggctacccgccccgaa
gatctgcgccgcccgggacatattttccccctgcgtgcccgggagggaggggtgctgcgc
cgggccggacataccgaggcagcggtagatctggcccgtctggccggcctgtacccggca
ggggtaatttgcgaggttatgaaggaagatgggaccatggcccgggtaccggagttaatg
gccttttgccggcaacacggtctaaaaatcattaccattgccgatttaatcaagtaccgg
cggcggacggaaaaactggtgcgccgggtggattctgcccatctgcccactaaatatggt
gattttactgccgtggcttatgagagcctgctggatggcaagggccatcttgccctggtt
aaaggggatttaagccaggtggaggcccccctggtgcgggtccattccgagtgcctgacc
ggcgatgtcttgggttccacccgctgcgattgcggtgatcagcttgcccgggccatgcaa
atgatcgccaaagaaggagtcggggtgctcctctacatgcggcaggaaggccggggtatt
ggccttttaaacaaaatccgtgcttacaagctgcaggatcaggggaaggatacggtggaa
gccaacgaggctttaggctttccacccgatttgcgggattacggtattggggctcaaatc
ctggctgatctggggctcaagaaaattcgtttgctcaccaacaacccccggaaaattgcc
ggtttggagggttacggcctggaagtggtggcccggatacccattgaggtatgtcccagc
aaatacaaccggttttacctggcgacgaaaagaaagaaactgggtcacctgctcagtatc
gccgatgaggtaagctag

DBGET integrated database retrieval system