KEGG   Desulfotomaculum kuznetsovii: Desku_1273Help
Entry
Desku_1273        CDS       T01499                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
dku  Desulfotomaculum kuznetsovii
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:dku00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Desku_1273
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desku_1273
   00620 Pyruvate metabolism
    Desku_1273
   00650 Butanoate metabolism
    Desku_1273
  Lipid metabolism
   00071 Fatty acid degradation
    Desku_1273
  Amino acid metabolism
   00350 Tyrosine metabolism
    Desku_1273
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Desku_1273
   00626 Naphthalene degradation
    Desku_1273
Enzymes [BR:dku01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Desku_1273
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Desku_1273
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1286240..1288948
Genome map
AA seq 902 aa AA seqDB search
MAEQGNFPEIDALVERANQAAREFARLDQEAVDRIVLNMALAGLDKHMELARMAVEETGR
GVYEDKATKNIFATEAVYHSIKYAKTVGVIEDNEEEGYLEVAEPVGVVAAVVPVTNPTST
TMFKSLICAKTRNPVIFSFHPGAQRCSAAAAKIMLEAAVAAGAPANCISWLENPNYDTTG
YLMRHPGVALIVATGGAGLVRAAYSTGKPALGVGPGNVPCYIEKTANLRRAVTDLIMSKT
FDNGLICASEQSVIIDREVADQVMDLMKENGCYFLNDEETRLLEELAVEQGNCTLNPRVA
GQSARRIAEMAGFAVPPDTRVLVVRLAGVGPEYPLSMEKLSPILSCYIVESFAEGLELCE
KVVEFGGLGHTAVIHSEDQKVIEEFSRRIRTGRIIVNSPATHGAIGDIYNVNVPSFTLGC
GSMGSNSTTSNVSVENLINIKRVAKRRAKLQWFRVPERIYFEPGSIQYLRKLPGVDRAFI
VTDPEIKRLGFVDKVLYHLNHRNNRVVTEVFYEVEPDPSVETVRRGCAVMNRFRPDTIIA
VGGGSAIDAAKAMWLFYEHPEVEFEFLKLKFMDIRKRTYKYPKLGRKAQLVAIPTTSGTG
SEVTAFAVITNKGEQVKYPLADYELTPDVAIIDPDFARTMPDRVAADTGMDVLTHALEAY
VSVMASDYTDAMAAKAVELVFHYLPRSYRNARDHKAREKMHNASCIAGMAFTNAFLGINH
AMAHQLGSAFHIPHGRANAVLLPYVVAYNASRPTKFVSFPQYEYFHAPEKYWQLARLLDL
PAGTVEEGVRSLIGAIFRLLRELDMPLTVADLGIERAVYERRIPEMADRAFADQTATTNP
RFPLVAELADLYRLAYGPPLSREVGEGLLDFSLLQGYRDGMAVPWPFRDGDAPEIRPENP
LQ
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
gtggctgagcagggaaattttcctgaaattgacgccctggtggaaagggccaaccaggcg
gcccgggaatttgcccgcctggatcaggaggcggtggaccgcattgtgctcaatatggcc
ctggccgggctggacaagcatatggaactggcccgcatggctgtggaagaaacgggccgg
ggtgtttatgaagacaaggcgaccaaaaacatttttgccacggaggcggtttatcatagc
attaaatacgccaaaaccgtgggtgtcatagaagacaatgaggaagaggggtacctggaa
gtggccgagcccgtgggagtggtggctgccgtggtgcccgtaaccaatcccacttccacc
accatgtttaagtccctgatctgcgccaaaacccggaacccggtgatcttcagcttccat
ccgggagcccagcgttgcagcgccgcggcggccaagatcatgctggaagcggcggttgct
gccggggcccccgcaaactgcatttcctggctggaaaaccccaactacgacaccacgggc
tatttaatgcggcaccccggcgtggccttgattgtggccaccgggggggccgggctggtg
cgggcggcctacagtaccgggaagcccgcccttggcgtggggccgggaaacgtgccctgc
tacattgaaaagaccgccaatttgaggcgggcggtaacagacctgatcatgagcaagacc
tttgacaacggtttaatctgtgcttccgaacaaagtgtgatcattgaccgggaagtggcc
gaccaggttatggacctcatgaaggaaaatggctgctatttcctgaatgatgaggaaacc
cgcctgctggaagaattggccgtggaacaggggaattgtacattaaatccccgggtggcc
gggcaatcggcccggaggattgcggagatggccggttttgctgtgccgccggacacaagg
gtcctggtagttcgcctggccggggtggggccggaataccccctgtccatggaaaagtta
agccccatcctctcctgctatatcgtggaaagttttgccgaagggttggagttatgtgaa
aaagtggtggaatttggcgggctgggccacacggcggtcattcattccgaagatcaaaaa
gtcattgaagagttctcccgccgcattcgcaccgggaggattatcgtcaattcgccggcc
acacacggggccatcggggatatctacaacgtgaacgtgccttcctttaccctgggctgc
ggctctatgggcagcaattccaccacttccaatgtcagtgtggaaaacctgatcaacatt
aagcgggtggccaagcgccgggctaagctgcaatggttccgggttcccgaacggatctat
tttgaacccggttctatacagtatttgcgcaaactccccggggtggacagggcctttatc
gtcaccgacccggagattaagcgtctgggttttgtggacaaggtgctttatcatctaaac
caccgcaataaccgggtggttaccgaggtcttttacgaggtggaaccggacccctcggta
gaaacggtgcgccggggatgtgcggtgatgaaccggtttcgtcctgacaccattattgcc
gtgggaggcggttcggccattgacgctgccaaggccatgtggcttttttatgaacacccg
gaagtggagtttgagtttctcaaactcaagtttatggatattcgcaagcgcacttacaag
taccccaaactggggcgcaaggcgcagctggtggccatacccaccaccagtggcaccggt
tcggaagtaacggcctttgccgtcattaccaacaagggcgagcaggtgaaatatcccctg
gccgattacgaactcacacccgacgtggccattattgacccggattttgcccgcaccatg
cctgacagggtggcggccgacacgggtatggacgtgcttacccacgccctggaggcctac
gtttcggtaatggcctcggattataccgatgccatggcggccaaggccgtagaactggtc
tttcactacctgccccgttcttaccggaatgcccgggaccacaaagcccgggaaaaaatg
cacaatgcctcctgtattgcgggtatggcttttaccaatgcgtttctaggcatcaatcac
gccatggcccaccagctggggtcagcctttcacattccgcacggccgtgccaatgccgtc
ctgctaccctacgtggtggcttacaatgccagccggccgaccaaatttgtttcctttccc
cagtacgaatacttccacgccccggagaaatactggcagctggcccggttgctggatttg
cctgcaggtacggtggaagagggggtgaggagcctcattggagccatcttccggctgtta
agggaactggacatgccccttaccgtggcggatctgggtattgaacgggcagtatatgag
cgcagaatccccgaaatggccgaccgggcctttgccgatcagaccgccaccaccaacccc
cgtttccctctggtggccgaactggccgacctttaccgtctggcctacggtcccccgttg
tcccgggaagtgggtgaggggcttttagatttttccctccttcaggggtacagggatggt
atggccgtcccctggcctttccgggacggggatgctccggaaatcaggccggaaaatccg
ttacagtga

DBGET integrated database retrieval system