KEGG   Desulfotomaculum kuznetsovii: Desku_1305Help
Entry
Desku_1305        CDS       T01499                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
dku  Desulfotomaculum kuznetsovii
Pathway
dku00230  Purine metabolism
dku01100  Metabolic pathways
Module
dku_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:dku00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Desku_1305
Enzymes [BR:dku01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Desku_1305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_18 ADK AAA_17 MMR_HSR1 AAA_22 Cytidylate_kin ABC_tran AAA_16 AAA RsgA_GTPase AAA_29
Motif
Other DBs
NCBI-ProteinID: AEG14888
JGI: Desku_1305
UniProt: F6CKU9
Position
1324621..1325250
Genome map
AA seq 209 aa AA seqDB search
MKSEGILMVLSGPSGAGKGTVCRALLEKQPGIHLSISATTRKPRAGEVDGVNYFFVSREK
FQQMIDAGELLEWAEVYGNYYGTPLKTVEDALARGEDVLLEIDVQGGLQVKKKFPSAVLV
FLLPPSRAVLAERLAGRGTDSIEEIQRRLHWANTELRFLFRYDYVVINRHVEEAVAVLQS
ILVAEKCRPQRIKMDESWGNLTDLKENSW
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcagagggcatattgatggtactgtccggtccttcgggggccggtaagggtacc
gtttgccgcgctttgctggaaaaacaaccggggattcacctttccatttccgctacgacc
agaaaaccccgggccggggaagtggacggggttaattacttttttgtctcccgggaaaaa
ttccagcaaatgatcgatgccggggaattgctggagtgggcggaggtctatggcaattat
tacggtacgccgctaaaaacggtagaggatgccctggccaggggtgaggatgtgctcctg
gagattgatgttcaggggggcttgcaggtaaaaaagaagtttccctcagcagtactggtt
tttctcctacccccttcccgggctgtgttggccgagcgccttgccggtcgcggtacggac
tccatcgaagagattcaaagacggttgcactgggctaacacggaactaaggttccttttc
cgttacgattatgtggtgattaaccggcatgttgaggaagcagttgctgtcctgcaatcg
attcttgtagccgaaaaatgccgtcctcagcgcataaaaatggatgaaagctggggtaat
ttaacggatcttaaagaaaattcctggtga

DBGET integrated database retrieval system