KEGG   Desulfotomaculum kuznetsovii: Desku_1305Help
Entry
Desku_1305        CDS       T01499                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
dku  Desulfotomaculum kuznetsovii
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:dku00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1324621..1325250
Genome map
AA seq 209 aa AA seqDB search
MKSEGILMVLSGPSGAGKGTVCRALLEKQPGIHLSISATTRKPRAGEVDGVNYFFVSREK
FQQMIDAGELLEWAEVYGNYYGTPLKTVEDALARGEDVLLEIDVQGGLQVKKKFPSAVLV
FLLPPSRAVLAERLAGRGTDSIEEIQRRLHWANTELRFLFRYDYVVINRHVEEAVAVLQS
ILVAEKCRPQRIKMDESWGNLTDLKENSW
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcagagggcatattgatggtactgtccggtccttcgggggccggtaagggtacc
gtttgccgcgctttgctggaaaaacaaccggggattcacctttccatttccgctacgacc
agaaaaccccgggccggggaagtggacggggttaattacttttttgtctcccgggaaaaa
ttccagcaaatgatcgatgccggggaattgctggagtgggcggaggtctatggcaattat
tacggtacgccgctaaaaacggtagaggatgccctggccaggggtgaggatgtgctcctg
gagattgatgttcaggggggcttgcaggtaaaaaagaagtttccctcagcagtactggtt
tttctcctacccccttcccgggctgtgttggccgagcgccttgccggtcgcggtacggac
tccatcgaagagattcaaagacggttgcactgggctaacacggaactaaggttccttttc
cgttacgattatgtggtgattaaccggcatgttgaggaagcagttgctgtcctgcaatcg
attcttgtagccgaaaaatgccgtcctcagcgcataaaaatggatgaaagctggggtaat
ttaacggatcttaaagaaaattcctggtga

DBGET integrated database retrieval system