KEGG   Desulfotomaculum kuznetsovii: Desku_1360Help
Entry
Desku_1360        CDS       T01499                                 

Definition
succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
dku  Desulfotomaculum kuznetsovii
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dku00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Desku_1360
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Desku_1360
   00640 Propanoate metabolism
    Desku_1360
   00660 C5-Branched dibasic acid metabolism
    Desku_1360
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Desku_1360
Enzymes [BR:dku01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Desku_1360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1384749..1385864
Genome map
AA seq 371 aa AA seqDB search
MKLYEYMGKELFARYGLTVPRGKMVTSPDEAAAVAAEIGAPVVIKSQVLSGKRGKGGGIK
FADTPEEAREAAAQVLGMTVQGLKVEMVLVEEKLAIDHEFYVAITVDGAAKAPVLIASAQ
GGMDIEEVPDEFIIKEHLDVCLGIQPYLCREVCRRLGLTGAVAKEFGRLLPTLYRIFREK
DAELVEINPLVLSGEKLIAADAKVTIDDEALYRQKDLPVVDDRTEAERQAHALGLSYVQL
DGNIAVMANGAGITMGTLDIIQHYGGAPANFLDAGGGTGMEATAKALEILLSTNPRVIFI
NIFGGITRCDDVARALVKVKQEKGINVPVVIRLVGTNEEEGVRILRENGIEAYRIMHEAA
AKAVELARAQG
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
gtgaaactctatgaatatatgggcaaggagctttttgcccgctacggtttgaccgtaccc
cggggtaagatggtcacctccccggatgaagcggcggcagtagcggcggaaatcggggca
ccggtggtaatcaagtcccaggtgctttcgggtaagcggggtaagggaggcgggattaag
tttgccgataccccggaagaggcccgcgaggcagctgcccaggttctgggcatgacggtt
cagggcctgaaagtagaaatggtcctggtggaagaaaagctggccatcgatcatgagttt
tatgtggccattaccgtagacggggcagccaaagcaccggttttaattgcctccgcccag
ggcggcatggatattgaagaggtccccgatgaatttatcatcaaggaacacctggatgtc
tgcctgggtatccagccctatttgtgccgggaagtttgccgccggttgggtctgacgggc
gcggtggccaaggaatttggccgtttgttgcctaccctttaccgtattttccgggagaag
gacgccgagctggtagagatcaacccgctggtgttgagcggcgaaaaattaattgccgcc
gatgccaaggtgactatcgatgacgaggccctgtaccggcaaaaggatctgcccgtagtg
gatgaccgtaccgaggccgaacggcaggcccacgccctggggctctcttacgttcagctg
gatgggaatattgctgttatggcaaatggtgccggcattaccatgggtaccctggatatc
atccagcattacggcggtgcgccagccaatttcctggatgccggcggcggcaccgggatg
gaggccacagccaaagcattagagatccttctttccaccaacccacgggtgatcttcatt
aacatctttgggggcattacccggtgtgatgatgtggccagggcactggtcaaggtgaag
caggagaagggaatcaatgttccggtagtcattcgtctagttggtaccaatgaagaagag
ggtgtacgcatcctcagggaaaatggcattgaagcctacagaattatgcatgaggctgcg
gccaaggctgtagaactggccagggcccagggttaa

DBGET integrated database retrieval system