KEGG   Desulfotomaculum kuznetsovii: Desku_1360Help
Entry
Desku_1360        CDS       T01499                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
dku  Desulfotomaculum kuznetsovii
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dku00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Desku_1360
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Desku_1360
   00640 Propanoate metabolism
    Desku_1360
   00660 C5-Branched dibasic acid metabolism
    Desku_1360
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Desku_1360
Enzymes [BR:dku01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Desku_1360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1384749..1385864
Genome map
AA seq 371 aa AA seqDB search
MKLYEYMGKELFARYGLTVPRGKMVTSPDEAAAVAAEIGAPVVIKSQVLSGKRGKGGGIK
FADTPEEAREAAAQVLGMTVQGLKVEMVLVEEKLAIDHEFYVAITVDGAAKAPVLIASAQ
GGMDIEEVPDEFIIKEHLDVCLGIQPYLCREVCRRLGLTGAVAKEFGRLLPTLYRIFREK
DAELVEINPLVLSGEKLIAADAKVTIDDEALYRQKDLPVVDDRTEAERQAHALGLSYVQL
DGNIAVMANGAGITMGTLDIIQHYGGAPANFLDAGGGTGMEATAKALEILLSTNPRVIFI
NIFGGITRCDDVARALVKVKQEKGINVPVVIRLVGTNEEEGVRILRENGIEAYRIMHEAA
AKAVELARAQG
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
gtgaaactctatgaatatatgggcaaggagctttttgcccgctacggtttgaccgtaccc
cggggtaagatggtcacctccccggatgaagcggcggcagtagcggcggaaatcggggca
ccggtggtaatcaagtcccaggtgctttcgggtaagcggggtaagggaggcgggattaag
tttgccgataccccggaagaggcccgcgaggcagctgcccaggttctgggcatgacggtt
cagggcctgaaagtagaaatggtcctggtggaagaaaagctggccatcgatcatgagttt
tatgtggccattaccgtagacggggcagccaaagcaccggttttaattgcctccgcccag
ggcggcatggatattgaagaggtccccgatgaatttatcatcaaggaacacctggatgtc
tgcctgggtatccagccctatttgtgccgggaagtttgccgccggttgggtctgacgggc
gcggtggccaaggaatttggccgtttgttgcctaccctttaccgtattttccgggagaag
gacgccgagctggtagagatcaacccgctggtgttgagcggcgaaaaattaattgccgcc
gatgccaaggtgactatcgatgacgaggccctgtaccggcaaaaggatctgcccgtagtg
gatgaccgtaccgaggccgaacggcaggcccacgccctggggctctcttacgttcagctg
gatgggaatattgctgttatggcaaatggtgccggcattaccatgggtaccctggatatc
atccagcattacggcggtgcgccagccaatttcctggatgccggcggcggcaccgggatg
gaggccacagccaaagcattagagatccttctttccaccaacccacgggtgatcttcatt
aacatctttgggggcattacccggtgtgatgatgtggccagggcactggtcaaggtgaag
caggagaagggaatcaatgttccggtagtcattcgtctagttggtaccaatgaagaagag
ggtgtacgcatcctcagggaaaatggcattgaagcctacagaattatgcatgaggctgcg
gccaaggctgtagaactggccagggcccagggttaa

DBGET integrated database retrieval system