KEGG   Desulfotomaculum kuznetsovii: Desku_1391Help
Entry
Desku_1391        CDS       T01499                                 

Definition
(RefSeq) 6-phosphofructokinase (EC:2.7.1.11)
  KO
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dku  Desulfotomaculum kuznetsovii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dku00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Desku_1391
   01230 Biosynthesis of amino acids
    Desku_1391
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desku_1391
   00030 Pentose phosphate pathway
    Desku_1391
   00051 Fructose and mannose metabolism
    Desku_1391
   00052 Galactose metabolism
    Desku_1391
  Energy metabolism
   00680 Methane metabolism
    Desku_1391
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Desku_1391
Enzymes [BR:dku01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Desku_1391
Protein phosphatases and associated proteins [BR:dku01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Desku_1391
Messenger RNA biogenesis [BR:dku03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Desku_1391
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1411157..1412257)
Genome map
AA seq 366 aa AA seqDB search
MAAPTKIKRIGVLTGGGDAPGLNAVIRAVVKVAIREYGLSVIGFLNGFGGLIKNQARELT
EKDVVGILPRGGTILGTTNRDNPFHYPVVKGGKKVFVDVSDRIFENISIHGVDALIVIGG
DGSLAIAKELYAKGLAVVGVPKTIDNDLLATDQTFGFDTALTTATEALDKLHTTAESHHR
VMVLEVMGRYAGWIALAAGVAGGADVILIPEIPYRIEKVIDMINQREVQGKKFSIIVVAE
GAKPVDGELVVQKRVEDSFDPIRLGGIGHVVAQQVEEATGKETRVTILGHLQRGGSPTAF
DRILATRYGTGAVRLVVEGRFGHMVCLRGTSIDAVPLTEATGQIRAVPLESDLLLSARQL
GICLGD
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggctgctccgactaaaattaaacgcattggtgtattaaccggcggaggcgacgctccc
ggactaaacgccgtcatcagggcggtggtaaaagtagctatcagggaatatggactttcg
gtaattggctttttaaacggttttgggggattgattaagaaccaggcccgggagcttacg
gaaaaggatgtagtgggtatcctgccccggggcggaactattctcggtaccaccaaccgt
gataatccctttcattatccagtggttaagggcgggaaaaaggtttttgtagacgtaagc
gatcgtatttttgaaaatatcagtatccacggggttgatgccctgatcgttatcggtgga
gatggcagcctggccattgctaaagagctgtacgctaaaggattggctgtggttggagtt
cctaagaccattgacaacgatttactggccacggatcaaactttcggttttgacactgcc
ctcaccaccgccaccgaagctctggacaagctacacactacggcggaatcccaccaccgg
gttatggttctggaggtaatggggcgttacgccggttggatagccctggctgccggggtg
gccggtggggctgacgtgatcttgattcctgaaattccctatcgcattgagaaggtcatc
gatatgatcaaccagcgggaagtacagggtaaaaagttcagcatcatcgtggtggccgaa
ggggctaaaccagtagacggagaattagtggttcaaaaaagggtggaggatagcttcgat
cccatccgtttgggtggcataggccatgtggtggctcaacaggtggaggaagccaccgga
aaagaaaccagggttactatactgggacacctgcaaagggggggttcccctacagccttt
gaccgcattctggctacacgctacggcacgggggcagtccggttggttgtggaagggcgt
ttcggacacatggtctgcctccggggcactagcattgacgccgtacccctcacggaagct
acagggcaaatccgcgccgtacccctagaaagcgatctgctgctctcggcaaggcaactg
gggatttgtctgggagattaa

DBGET integrated database retrieval system