KEGG   Desulfotomaculum kuznetsovii: Desku_1419Help
Entry
Desku_1419        CDS       T01499                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
dku  Desulfotomaculum kuznetsovii
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:dku00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1434975..1435535)
Genome map
AA seq 186 aa AA seqDB search
MIDTEKIEKAVRMILEAIGEDPDREGLRETPARVARMYKEIFCGLWEDPELHLEKIFTEE
HEEMILVKDIPIYSMCEHHLLPFFGKAHVAYIPRRGKVTGLSKLARVVEGFAKRPQLQER
LTTQIADSIMRRLNPQGVLVVIEAEHMCMTLRGIRKPGSKTITSAVRGSFQRSEATRAEA
LALIKD
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgattgataccgaaaagattgaaaaagcggtacgcatgattttagaagccatcggcgag
gaccctgaccgggagggactaagggaaacgccggcccgggtagccagaatgtacaaagaa
attttttgtggtttatgggaagatccggaattacacttagaaaaaatatttaccgaggaa
catgaagaaatgatcctggtgaaggacatccccatatattctatgtgcgagcatcacctg
ttacccttctttggcaaggcccatgtagcctatatacccaggcggggtaaagtaacgggg
ctttccaagctggcacgggtggtggagggatttgccaaacgcccccaattacaagagcgc
ctgaccacccagatcgccgacagcattatgcgccggctaaatccgcaaggtgtgctggtt
gtaattgaggcggagcacatgtgcatgactctgcggggaatccgtaagcctggctcaaaa
accattacctcggcagttcgtggttcttttcaaagaagcgaggccacaagggcagaagcc
ctggccctcattaaggactag

DBGET integrated database retrieval system