KEGG   Desulfotomaculum kuznetsovii: Desku_1419Help
Entry
Desku_1419        CDS       T01499                                 

Definition
(GenBank) GTP cyclohydrolase 1
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
dku  Desulfotomaculum kuznetsovii
Pathway
dku00790  Folate biosynthesis
dku01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dku00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Desku_1419
Enzymes [BR:dku01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Desku_1419
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF Orbi_VP2 FolB EIF_2_alpha
Motif
Other DBs
NCBI-ProteinID: AEG15002
JGI: Desku_1419
UniProt: F6CQX7
Position
complement(1434975..1435535)
Genome map
AA seq 186 aa AA seqDB search
MIDTEKIEKAVRMILEAIGEDPDREGLRETPARVARMYKEIFCGLWEDPELHLEKIFTEE
HEEMILVKDIPIYSMCEHHLLPFFGKAHVAYIPRRGKVTGLSKLARVVEGFAKRPQLQER
LTTQIADSIMRRLNPQGVLVVIEAEHMCMTLRGIRKPGSKTITSAVRGSFQRSEATRAEA
LALIKD
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgattgataccgaaaagattgaaaaagcggtacgcatgattttagaagccatcggcgag
gaccctgaccgggagggactaagggaaacgccggcccgggtagccagaatgtacaaagaa
attttttgtggtttatgggaagatccggaattacacttagaaaaaatatttaccgaggaa
catgaagaaatgatcctggtgaaggacatccccatatattctatgtgcgagcatcacctg
ttacccttctttggcaaggcccatgtagcctatatacccaggcggggtaaagtaacgggg
ctttccaagctggcacgggtggtggagggatttgccaaacgcccccaattacaagagcgc
ctgaccacccagatcgccgacagcattatgcgccggctaaatccgcaaggtgtgctggtt
gtaattgaggcggagcacatgtgcatgactctgcggggaatccgtaagcctggctcaaaa
accattacctcggcagttcgtggttcttttcaaagaagcgaggccacaagggcagaagcc
ctggccctcattaaggactag

DBGET integrated database retrieval system