KEGG   Desulfotomaculum kuznetsovii: Desku_1518Help
Entry
Desku_1518        CDS       T01499                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
dku  Desulfotomaculum kuznetsovii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dku00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Desku_1518
Enzymes [BR:dku01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Desku_1518
Exosome [BR:dku04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Desku_1518
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1527896..1528873)
Genome map
AA seq 325 aa AA seqDB search
MAFPITRPRRLRVKENIRRLVRETCLTVDDLIYPLFVAHGRGVQSPVEAMPGVYNLSPDM
LLEEAARVVDLGIPGILLFGIPREKDETAREAYDDEGIVQQAVRAIKKEFPELVVITDVC
LCEYTSHGHCGVVEQGRILNDPTLELLARTALSHARAGADMVAPSDMMDGRVAAIRRALD
EAGYQDVSIMSYAAKYASAYYGPFREAVGSAPQFGDRRSYQMDPPNAREALREIALDIEE
GADIIMVKPALAYLDIVRQARDAFNYPVAVYNVSGEYAMVKAAALRGWIDERRVVLETLT
GMKRAGADIIITYHAKDVARWLREG
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
gtggcctttcccataacccgtccccgccgtttgcgggtgaaggaaaacatccgccgcctg
gtgcgggaaacctgcctgacggtagacgaccttatctacccgctttttgtcgcccacggc
cggggggttcaaagccccgtagaagccatgcccggggtgtataatctttccccggatatg
ctcctggaagaagcagcccgggtggtcgatctgggcatacccggcattctccttttcggc
attccccgggaaaaagatgaaacagcacgggaagcttatgacgatgaggggattgtgcag
caggccgtgcgggcaattaagaaggagttccccgaactggtggtcattaccgacgtctgt
ctctgtgaatacaccagccacggtcactgtggagtggtagaacagggacgcattctcaac
gacccgaccctcgagctcctggcccgtacggccctttcccatgcccgggccggagccgac
atggtagctccttccgacatgatggacggccgggtggccgccatccgccgtgccctggac
gaagccggttaccaggatgtatccatcatgtcctatgcagccaagtatgcgtcggcctat
tatggccccttccgggaagcggtgggctcggcaccccagttcggagaccgccgctcctac
cagatggacccccccaatgcccgggaggctctgcgggagatagccctggatattgaagaa
ggggccgacattatcatggtcaaacctgctctggcctacctggatattgtccggcaggcg
cgggatgcttttaactaccccgtagcagtttataacgtcagcggggaatatgccatggtt
aaggctgcggccctgcggggctggattgacgaacgccgggttgtcctggaaaccctcacc
ggaatgaaacgggccggggccgacattatcatcacttaccacgccaaggacgtggcccgc
tggttacgagaaggttag

DBGET integrated database retrieval system