KEGG   Desulfotomaculum kuznetsovii: Desku_1652Help
Entry
Desku_1652        CDS       T01499                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dku  Desulfotomaculum kuznetsovii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dku00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Desku_1652
   01230 Biosynthesis of amino acids
    Desku_1652
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desku_1652
   00030 Pentose phosphate pathway
    Desku_1652
   00051 Fructose and mannose metabolism
    Desku_1652
   00052 Galactose metabolism
    Desku_1652
  Energy metabolism
   00680 Methane metabolism
    Desku_1652
Enzymes [BR:dku01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Desku_1652
Protein phosphatases and associated proteins [BR:dku01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Desku_1652
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1648114..1649076)
Genome map
AA seq 320 aa AA seqDB search
MQRIGILTSGGDSPGMNAAIRAVVRKAIYHGLEVIGIKRGFNGFIDGDMEPMRLGSVADI
IHRGGTVLHTARSEQFKTPAGRAKAWENVERFGLEGLVVIGGDGSFTGASIFHREYGLPV
VAIPGTIDNDISGTDYSIGFDTAVNTAVDAINKIRDTATSHERTFIVEVMGRDTGFIAVA
AGLAGGAESILIPEHPFSIEEVCHKLCKGYRRGKLHSIIVVAEGAGSGLEIGKQIKERTG
FDTKVTILGHLQRGGTPTAFDRILASQLGARAVELLMQGATCKMVGMAAGKIVETDLDLV
LGQKKTVDLDVYRLASILAI
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
ttgcaaaggataggtattttgaccagcggcggcgattctccgggaatgaatgcggccatc
cgggcggtggtgcgcaaggctatttatcacggcctggaagtgattggtatcaaaaggggc
tttaacggttttattgatggtgacatggaacccatgcggctgggttcggtagcagatatc
attcaccggggaggaaccgttttacatacggcccgctccgagcagttcaaaacgcccgcg
gggcgggccaaagcatgggaaaatgtggagcggtttggcctggaggggctggtggttatt
ggcggtgacggctcctttactggagccagcatcttccaccgggaatacgggctcccggtg
gtggccatcccgggaaccatcgacaatgatatcagcggtacggattattccattggtttt
gataccgccgtaaacactgcggttgacgccatcaacaagatccgtgacaccgccacctcc
catgagcgcacctttatagtggaggtaatgggacgcgacacgggttttatcgccgtagcc
gccggcctggccggaggagcggaatccattctcattcccgaacatcctttcagcattgaa
gaagtttgccacaaactttgcaagggctaccggcgcgggaaactgcacagcatcatcgtg
gtggccgagggggcaggcagcgggctggaaataggcaaacaaattaaggaacgcaccggc
tttgataccaaagtgaccattctgggccacctgcaacggggtggcacccccacagctttt
gaccgcattctggccagccagctgggagcccgggccgtggaattgctcatgcaaggggca
acctgtaaaatggtcggtatggccgcggggaaaatagtggaaaccgacctggacctggtc
ctggggcagaagaaaaccgttgatcttgatgtttaccggctggcgagcattttagccata
taa

DBGET integrated database retrieval system