KEGG   Desulfotomaculum kuznetsovii: Desku_1693Help
Entry
Desku_1693        CDS       T01499                                 

Definition
(GenBank) Histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
dku  Desulfotomaculum kuznetsovii
Pathway
dku00340  Histidine metabolism
dku01100  Metabolic pathways
dku01110  Biosynthesis of secondary metabolites
dku01230  Biosynthesis of amino acids
Module
dku_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:dku00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Desku_1693
Enzymes [BR:dku01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Desku_1693
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: AEG15271
JGI: Desku_1693
UniProt: F6CH54
Position
complement(1695519..1696826)
Genome map
AA seq 435 aa AA seqDB search
MIRILNAGDPALEQLLARHPADREEAAARVREILAGVRDGGDQALCRYTARFDGINLTPE
ELKVKREEISEAKKQVKGEFLAALAVAAENITAYHRRQLTNSWIEPGARGLLVGQLVRPL
ARVGVYVPGGTAAYPSSVLMNVLPARVAGVKEIAMVTPPDREGKINPHTLVAADLAGVTE
IYKVGGAQAIAALAYGTQTIRPVDKIVGPGNLYVTLAKQQVFGLVDIDMLAGPSEVLVIA
DDSADPRHVAADMLSQAEHDPLARALLLTPDGWLAQAVKEELERQLNDLPRREIAAGSLA
SHGAIILTRDIAQAVDLANRFAPEHLELVVREPFSWLGRIATAGAVFLGPHAPEPLGDYL
AGPSHVLPTGGTARFYSPLGVDTFLKRISVISCSREAFLEMAPHIIRLARVEGLDAHARA
IEIRLDTSCRESEKS
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
ttgattagaattcttaatgcgggcgacccggccctggagcaactcctggcccgccacccg
gccgaccgggaggaggctgccgccagggtaagggagatccttgccggcgtgcgggacgga
ggggaccaggccctctgccggtatacggcccgcttcgatggaattaacctgactccggaa
gaactgaaggtaaagcgggaagaaatctccgaagccaaaaagcaggttaaaggggaattc
ctcgctgccctggcggtggcggcggagaacatcaccgcctaccaccgccgccagttgacc
aactcctggattgaacccggcgcccggggcctcctggtgggacagcttgtgcgtcccctg
gcccgggttggtgtttacgtgccgggaggtacggcagcttatccctcttcagtattgatg
aacgtccttcccgcccgggtggccggggtgaaggaaatcgccatggtcacccctcccgac
cgcgagggtaaaattaatccccacactctggtggctgccgacctggcgggagtaacggaa
atttacaaggtaggcggggcgcaggccattgccgccctggcctatggaacgcaaaccatc
cggccggtggacaaaatcgtcgggccgggcaatctttacgttaccctggccaagcagcag
gtctttggcctggtggatatcgacatgctggcggggcccagcgaagtgctggtaatcgcc
gatgattcggccgatccccggcatgtggccgccgacatgctttcccaggccgaacacgat
cccctggcccgggccctgcttctcactccggacggctggctggcacaggccgtcaaggag
gaactggagcgccagctgaacgatttgccgcggcgggaaattgccgccggttctctagcc
agccacggagccattatcctgacccgggacattgcccaggccgtggacctggccaaccgc
ttcgctccggaacatctggaactggtggtgagggaacctttctcctggctgggacgcatt
gctacggccggggccgtttttctggggccccacgccccggaacccctgggggattacctg
gccggccccagccatgttctgcccaccgggggcaccgcccgtttttattcccccctgggc
gtggatacctttttaaaaagaatcagcgttatttcctgctcccgggaagcgttcctggaa
atggccccccacattatccggctggcccgggtggaaggcctggacgcccacgccagggcc
atagagataaggttggacacgtcatgccgggagagtgaaaaatcatga

DBGET integrated database retrieval system