KEGG   Desulfotomaculum kuznetsovii: Desku_1820Help
Entry
Desku_1820        CDS       T01499                                 

Definition
response regulator receiver modulated CheB methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
dku  Desulfotomaculum kuznetsovii
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:dku00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Desku_1820
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Desku_1820
Enzymes [BR:dku01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Desku_1820
Two-component system [BR:dku02022]
 CheA family
  CheA-CheYBV
   Desku_1820
Bacterial motility proteins [BR:dku02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Desku_1820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1817890..1819245)
Genome map
AA seq 451 aa AA seqDB search
MLVVDDSALMRRLITRLLESRGYNVIDTAADGKEAVAKICALKPDVVSLDLEMPVLDGLG
VLRRVMKECPVPVVMLSSHTTAGARATMRALSLGAVDFVAKPSGPGRLDAMVDELVEKLR
AAATVAASKLVRPGVGMAFHPFPAGKAGPSLPPPRGKRPGDARTPPGPPGKPAGVSGRKE
VPPVIPADIGSVPEQHAGTPSSMPPARDGMLSLHPAGRSPTGAPAGTAGRAADAGRAKAD
RDTTAGGTVPRLVVVPKRSPRIDLVVIGSSTGGPAALQVIIPALPEDFPAAVVLVQHLPV
GFSGPLAEHLNRRSRLPVKHAEEGDPVVPGRVLVAPAGFDLTFRGRPGHVTVHLNAGSGP
VPPGGFRPSVDGVMLSAAEIFGARVMGVLLTGMGRDGARGMAAIREKGGPTIAQDESTCV
VFGMPKAAIDLGAALKVVPLGEVAGEIARLV
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
gtgctggtagtggacgactcggccttgatgcgccgtttaatcacccgcctgctggaaagc
cgggggtataatgtaattgacaccgcggcggacggtaaagaggcggtggccaagatctgc
gccctgaaacccgacgtggtctccctggacctggaaatgccggtactggacggcctgggg
gtactgcgaagggtgatgaaggaatgccccgtcccggtggtcatgctcagctcccacacc
accgccggcgcccgggccaccatgcgggccctgtctctgggagcggtggattttgtagcc
aaaccctccggcccggggcggctggacgccatggtcgacgagctggtggaaaaactgcgc
gccgccgccacagtggccgcaagcaagctggtacgccccggggtgggcatggcatttcac
ccgtttcccgccggaaaagccgggccttcactgccgccaccccggggaaaaaggccgggg
gatgcccggacgcctcccggcccgccgggcaaaccggccggcgtctccggcaggaaagag
gtgcccccggttataccggcagacataggctccgttccggaacagcatgccggtacaccc
tccagcatgccgcccgccagggatggaatgctttccttgcaccccgcaggccgttcaccg
accggggctcccgccggtacggccggcagggccgctgacgccggcagggcgaaagcggac
cgggacaccacggccggcggcactgtgccccggctggtggtggtaccaaaacgctcccct
cgtatcgacctggtcgtaataggctcctccaccggcggcccggccgcgctgcaggtgatt
attcccgccctgccggaagattttcccgccgccgtggtgctggtgcagcacctgccggtg
ggcttttccggccccctggccgaacacctgaaccgccgcagccgcctgccggtaaaacac
gcagaagaaggcgatcccgtcgtcccgggccgggtgctggtggccccggccggtttcgac
ctcacctttcgcgggcggcccggtcatgtcaccgttcacctgaacgccggcagcgggccc
gtgcctcccggggggttccgcccttcggtggacggggtgatgctctcggcggcggaaatc
ttcggggcacgggtcatgggggtcctcctcacgggcatgggccgggacggcgccaggggc
atggccgccatcagggaaaaaggcggccccaccatcgcccaggacgaatccacgtgtgtg
gtcttcggcatgcccaaagcggccatcgacctgggagcggcactgaaagtcgtccccctg
ggggaagtggcgggggagatcgccaggctggtgtag

DBGET integrated database retrieval system