KEGG   Desulfotomaculum kuznetsovii: Desku_1851Help
Entry
Desku_1851        CDS       T01499                                 

Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
dku  Desulfotomaculum kuznetsovii
Pathway
dku00260  Glycine, serine and threonine metabolism
dku00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dku01100  Metabolic pathways
dku01110  Biosynthesis of secondary metabolites
dku01130  Biosynthesis of antibiotics
dku01230  Biosynthesis of amino acids
Module
dku_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dku00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Desku_1851
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Desku_1851
Enzymes [BR:dku01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Desku_1851
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA Pterin_bind
Motif
Other DBs
NCBI-ProteinID: AEG15414
JGI: Desku_1851
UniProt: F6CML7
Position
complement(1853672..1854481)
Genome map
AA seq 269 aa AA seqDB search
MKGNRITQRFSALAQEGKKGLITYITAGYPDLDTTARLVKTMVEAGADLVEVGIPFSDPV
ADGPVIQQASARALANGVRVKDIIRMCADIRQKSTAVPLILMTYYNPVFQYGLESFARDA
ARAGVDGLIVPDLPFEESEELLGHTDHYGLALIPLVAPTTTEKRLAAMAPAARGFVYCVS
VTGVTGAREEIHTDLAKFTQKVRRHLQLPCAIGFGIAGPAQAAAVAPYCDAMVVGSAIVD
LVARAGTGDPAPAVAALVKDIKCAIEKCA
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggaaaccgtatcacccagcgtttttccgccctggctcaagaagggaaaaagggg
ctaatcacttacattaccgccgggtacccggatctggatacaaccgcccggctggtcaag
accatggtagaggccggggccgacctggtggaagtgggcatccccttttcggaccccgta
gccgacggcccggtcatccagcaggcctccgcccgggccctggccaacggcgtgcgggtt
aaggacatcatccgcatgtgcgccgatatccggcaaaaaagcaccgctgttcctttaatc
ctgatgacctactacaatcccgtttttcagtacgggttggaaagttttgcccgggacgcc
gcccgggccggggtggacggcctgatcgtgcccgacctgccctttgaagagagcgaagaa
ttgctggggcatactgatcattacggactcgccctcatacccctggtggctcccaccacc
accgaaaaaaggctggccgccatggctcccgcggcccggggctttgtctactgcgtttcg
gttaccggggtgaccggtgcccgggaggaaattcacaccgacctggcgaaattcacgcaa
aaggtgcgccggcacctacagcttccctgcgccattggcttcggcattgccggtccggcg
caggctgccgcggtggcaccatactgtgatgccatggtggtgggcagcgccatcgtcgac
ctggtggcccgggcgggaacgggcgatcccgctccggcggtggctgccctggtcaaggat
atcaagtgcgctatcgaaaagtgtgcctga

DBGET integrated database retrieval system