KEGG   Desulfotomaculum kuznetsovii: Desku_1852Help
Entry
Desku_1852        CDS       T01499                                 

Definition
(GenBank) Tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dku  Desulfotomaculum kuznetsovii
Pathway
dku00260  Glycine, serine and threonine metabolism
dku00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dku01100  Metabolic pathways
dku01110  Biosynthesis of secondary metabolites
dku01130  Biosynthesis of antibiotics
dku01230  Biosynthesis of amino acids
Module
dku_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dku00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Desku_1852
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Desku_1852
Enzymes [BR:dku01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Desku_1852
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AEG15415
JGI: Desku_1852
UniProt: F6CML8
Position
complement(1854534..1855724)
Genome map
AA seq 396 aa AA seqDB search
MSLPDERGYFGSFGGRYVPETLMPALEELTAAYQEARRDPSFWQELEYYLQQYVGRPSPL
YFARRLSEHCRGARIYLKREDLNHTGAHKINNTIGQILLARRMGKKRIIAETGAGQHGVA
TATAAALFGMECAVYMGEEDMARQALNVFRMRILGATVVGVAAGSRTLKDAMNEAMRDWV
TNVDTTYYLIGSVAGPHPYPVMVRDFQRVIGVETRRQVQEQTGRLPDVIVACVGGGSNAM
GIFHPFLEDREVKLVGVEAAGCGLETGKHAATLNRGRPGILHGSKSYVLQDEDGQINLAH
SISAGLDYPGVGPEHSYLKETGRVVYTAVTDEEALEAFQLLCRTEGIIPALESAHALAQA
VKMAGEMPQDAIIVVNLSGRGDKDVQTVARALGGEG
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttaccggatgagcggggctactttggatcctttggaggccgttacgtgccggaa
accctcatgccggccctggaagaactgaccgcggcctaccaggaagcccgccgggacccg
tccttctggcaggagctggaatattatctgcagcaatacgtgggacggccctcaccgttg
tattttgcccgccgtctgagtgaacactgccggggggccaggatttatctcaagagggaa
gacctcaaccacaccggtgcccacaagataaataataccattggccagattctcctggcc
cgacgcatgggtaagaaacggattattgccgaaacgggtgccggccagcacggggtggcc
acagctaccgccgctgcgctgttcggcatggaatgtgccgtatacatgggcgaagaggat
atggcccgccaggccctgaacgtcttccgcatgcgcatcctgggtgccacggtggttggt
gtggcggcgggcagccgcaccctgaaagatgccatgaacgaagccatgcgggactgggtg
accaatgtcgataccacttattacctgatcgggtcggtagccggcccccatccctatccc
gtgatggtgcgggatttccagcgcgtgattggggtggagacccgccggcaggtgcaggaa
caaaccgggaggctgcccgatgtaatcgtggcctgcgtgggcggggggagcaatgccatg
ggcatattccaccccttccttgaagacagggaagtaaaactggtcggggtggaagcagcg
ggctgcgggctggaaaccggcaaacacgccgccacccttaaccggggccgcccgggtatt
ctgcacgggtcgaaaagctacgtcctgcaggatgaagatggccagatcaacctggcccac
tccatttccgccgggctggattatcccggtgtgggccccgagcacagctatttgaaagaa
acgggccgggtcgtatatactgccgtaaccgatgaagaggccctggaagcctttcaactg
ctctgccgcaccgagggaatcattccggctctggaaagtgcccatgccctggcccaggca
gtgaagatggccggggaaatgcctcaagatgccatcatcgtggtaaacctctccggccgg
ggggacaaggatgtgcaaaccgtggcccgcgccctgggaggggagggctaa

DBGET integrated database retrieval system