KEGG   Desulfotomaculum kuznetsovii: Desku_1873Help
Entry
Desku_1873        CDS       T01499                                 

Definition
(RefSeq) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dku  Desulfotomaculum kuznetsovii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dku00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Desku_1873
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Desku_1873
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Desku_1873
Enzymes [BR:dku01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Desku_1873
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1876219..1877583)
Genome map
AA seq 454 aa AA seqDB search
MSETKILLTEREMPTHWYNIQADMPQLPRPPLHPATGKPVGPDDLKAIFPTSLIEQEMTR
ERWVEIPEEVREIYRLWRPSPLHRAHRLEKALDTPARIFYKYEGVSPAGSHKLNTAVPQA
YFNKKEGIKRLTTETGAGQWGVALSQACNFFGLECTVYMVKVSYHQKPYRRSMMEIFGAK
VYASPSEQTAAGRRILSAEPDSPGSLGIAISEAVEDAAGREDTNYALGSVLNHVLLHQTV
IGLEAREQMARAGYYPDVVIACCGGGSNFGGLAFPFAHDKLVRGSKVRLVAVEPSACPTL
TRGKFAYDYGDVAGLTPLLPMYTLGAEFMPPGIHAGGLRYHGDSPLVSQLVHDGVVEARA
FNQTDVFQSAIMFARSEGIVPAPESAHAIACAIKEALAAREAGEARTILFNLSGHGFLDL
PSYDAYLAGKLEDYPLPEEELARSLSRLPRVDLG
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaaccaaaatcctgcttacggaaagagaaatgcctacgcactggtacaacatc
caggccgacatgcctcaattgccccgaccgccattacatccggctaccggaaagccagta
ggaccggatgatctaaaggccatttttcccacgtcattgattgaacaggaaatgacccgg
gaacgctgggtggaaattccggaagaagtgcgggaaatttatcgcctttggcggcccagt
cccctacaccgggcgcaccgcctggaaaaggccctggacacgccggcccgcatcttttat
aaatacgagggagtaagtcccgccggaagtcataagttgaacacggctgtaccccaggct
tatttcaacaaaaaggaaggtatcaaaaggttgaccacggaaacgggagcaggccagtgg
ggcgtagccctgtcccaggcatgtaatttttttggccttgaatgtaccgtgtacatggtc
aaagtcagctaccaccagaaaccctaccgccgctccatgatggaaatattcggggccaaa
gtctatgccagccccagcgaacaaactgccgccgggcgcaggatcttaagcgccgaaccc
gattcccccggcagcctgggcattgccatcagcgaagcggtggaagatgctgccggccgg
gaagataccaattacgccctgggcagcgtgctcaaccacgttcttttgcaccaaacggtg
atcggtctggaggccagggaacaaatggccagggccgggtactacccggacgtggtcatc
gcctgctgtggcggtgggagtaactttggagggctggctttcccctttgcccatgacaag
ctggtgcggggatcaaaggtgcggctggtggccgtggagcccagcgcctgtcccaccttg
acccggggcaaatttgcttacgattacggcgatgtggccgggctaacgccccttctgccc
atgtataccctgggggccgagttcatgcctcccggaatccatgccgggggcctgcgctac
cacggagactcccccctggtaagccagctggtgcatgacggcgttgtcgaagcgcgggcc
tttaaccagaccgatgtctttcaaagtgccatcatgtttgcccgctccgagggaatcgta
ccggctcccgagtccgcccacgccattgcctgcgccattaaagaagccctggcagccagg
gaagcaggggaggcgagaaccatcctgttcaacttgagcggccatggtttcctggatctg
ccctcctatgacgcctacctggccggcaagctggaggactaccccctgccggaagaagag
ctggccaggtccctatcccggcttcccagggtggatttggggtag

DBGET integrated database retrieval system