KEGG   Desulfotomaculum kuznetsovii: Desku_1873Help
Entry
Desku_1873        CDS       T01499                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dku  Desulfotomaculum kuznetsovii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dku00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Desku_1873
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Desku_1873
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Desku_1873
Enzymes [BR:dku01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Desku_1873
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1876219..1877583)
Genome map
AA seq 454 aa AA seqDB search
MSETKILLTEREMPTHWYNIQADMPQLPRPPLHPATGKPVGPDDLKAIFPTSLIEQEMTR
ERWVEIPEEVREIYRLWRPSPLHRAHRLEKALDTPARIFYKYEGVSPAGSHKLNTAVPQA
YFNKKEGIKRLTTETGAGQWGVALSQACNFFGLECTVYMVKVSYHQKPYRRSMMEIFGAK
VYASPSEQTAAGRRILSAEPDSPGSLGIAISEAVEDAAGREDTNYALGSVLNHVLLHQTV
IGLEAREQMARAGYYPDVVIACCGGGSNFGGLAFPFAHDKLVRGSKVRLVAVEPSACPTL
TRGKFAYDYGDVAGLTPLLPMYTLGAEFMPPGIHAGGLRYHGDSPLVSQLVHDGVVEARA
FNQTDVFQSAIMFARSEGIVPAPESAHAIACAIKEALAAREAGEARTILFNLSGHGFLDL
PSYDAYLAGKLEDYPLPEEELARSLSRLPRVDLG
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaaccaaaatcctgcttacggaaagagaaatgcctacgcactggtacaacatc
caggccgacatgcctcaattgccccgaccgccattacatccggctaccggaaagccagta
ggaccggatgatctaaaggccatttttcccacgtcattgattgaacaggaaatgacccgg
gaacgctgggtggaaattccggaagaagtgcgggaaatttatcgcctttggcggcccagt
cccctacaccgggcgcaccgcctggaaaaggccctggacacgccggcccgcatcttttat
aaatacgagggagtaagtcccgccggaagtcataagttgaacacggctgtaccccaggct
tatttcaacaaaaaggaaggtatcaaaaggttgaccacggaaacgggagcaggccagtgg
ggcgtagccctgtcccaggcatgtaatttttttggccttgaatgtaccgtgtacatggtc
aaagtcagctaccaccagaaaccctaccgccgctccatgatggaaatattcggggccaaa
gtctatgccagccccagcgaacaaactgccgccgggcgcaggatcttaagcgccgaaccc
gattcccccggcagcctgggcattgccatcagcgaagcggtggaagatgctgccggccgg
gaagataccaattacgccctgggcagcgtgctcaaccacgttcttttgcaccaaacggtg
atcggtctggaggccagggaacaaatggccagggccgggtactacccggacgtggtcatc
gcctgctgtggcggtgggagtaactttggagggctggctttcccctttgcccatgacaag
ctggtgcggggatcaaaggtgcggctggtggccgtggagcccagcgcctgtcccaccttg
acccggggcaaatttgcttacgattacggcgatgtggccgggctaacgccccttctgccc
atgtataccctgggggccgagttcatgcctcccggaatccatgccgggggcctgcgctac
cacggagactcccccctggtaagccagctggtgcatgacggcgttgtcgaagcgcgggcc
tttaaccagaccgatgtctttcaaagtgccatcatgtttgcccgctccgagggaatcgta
ccggctcccgagtccgcccacgccattgcctgcgccattaaagaagccctggcagccagg
gaagcaggggaggcgagaaccatcctgttcaacttgagcggccatggtttcctggatctg
ccctcctatgacgcctacctggccggcaagctggaggactaccccctgccggaagaagag
ctggccaggtccctatcccggcttcccagggtggatttggggtag

DBGET integrated database retrieval system