KEGG   Desulfotomaculum kuznetsovii: Desku_2054Help
Entry
Desku_2054        CDS       T01499                                 

Definition
(GenBank) Acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
dku  Desulfotomaculum kuznetsovii
Pathway
dku00010  Glycolysis / Gluconeogenesis
dku00620  Pyruvate metabolism
dku00640  Propanoate metabolism
dku00680  Methane metabolism
dku00720  Carbon fixation pathways in prokaryotes
dku01100  Metabolic pathways
dku01110  Biosynthesis of secondary metabolites
dku01120  Microbial metabolism in diverse environments
dku01130  Biosynthesis of antibiotics
dku01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dku00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desku_2054
   00620 Pyruvate metabolism
    Desku_2054
   00640 Propanoate metabolism
    Desku_2054
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Desku_2054
   00680 Methane metabolism
    Desku_2054
Enzymes [BR:dku01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Desku_2054
Lipid biosynthesis proteins [BR:dku01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Desku_2054
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AEG15609
JGI: Desku_2054
UniProt: F6CMP7
Position
complement(2037255..2038946)
Genome map
AA seq 563 aa AA seqDB search
MRGKIIPARPGEHNLKDYVRARKEFDFASVEPEFSWYTTGRVNVVYEAVDRQVEEKGLEQ
QVALYFESGEKQEEYTFGRLQRETARFAAVLKKYGLQKGDRLGIFMPRSPELYISFLGAA
RLGVVVVPLFEAFMAEALKDRLGDCGAVAVVTTPELYPRLPLDQLPALKHVFVVGENVPA
GTLDWHREISLVTETPPMEWVGREHPLFILYASGADGKARGLVHVHNIMVGLLITARWVH
DLRPGDVYWCTADPGWITGIAYGFLAPWLLGIPVVVRGGRFNAEDWCATLAKYRVSVWYS
APTAFRMIMSGGDELLSRYDLSRLRHILSVGEPLTEEVMEWSLAKLGQPIYDTWWMSETG
MNMICNYRCMPIKIGSIGLPFPGIEAAVVDDEGRELPPGRIGNLAIRAGWPAQIRAVWND
PARYEEYFRHKPWFISGDAAYRDEDGYFYFQGRLDGVINTSGERVGPAEVESKLEEHPAV
ARAGVAGKPDKLRGEIVKAFIVLNPGYTWSDELAAELREFVKTGLAAHAAPREFEVKESI
PLTRDGRVDRRVLREWVLFRQDF
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgagagggaaaatcattcccgcccggccgggcgaacacaatttgaaagattacgtgcgg
gcgcggaaagagtttgactttgccagtgtggaacccgagttcagctggtacaccaccgga
cgggtcaatgttgtttatgaggctgtggaccggcaggtggaagaaaaggggttggagcag
caggttgccctttatttcgaatcaggagaaaaacaggaagagtataccttcggtcgcctg
cagagggagacggcccggtttgccgcggttttaaaaaaatacggcctgcaaaagggtgac
cggctgggtatttttatgccccgcagcccggagctctatatcagctttttgggggccgcc
cggctgggcgtggtggttgtgcccctctttgaggcctttatggctgaagccctgaaggac
cgcctgggggactgcggggcggtggccgtggtaactacacccgaactttatccccgcctg
cccctggatcagttgccggctttaaagcacgtttttgtggtgggggaaaacgtcccggcc
ggtacgctggactggcacagggaaatttccctggtcacggaaacgccccccatggaatgg
gtgggccgggagcatcctttatttatcctttacgcatccggggcggacggcaaggcccgg
ggcctggtacacgtgcacaacatcatggtcggccttttgattaccgcccgctgggtgcac
gacctgcggcccggcgacgtttactggtgtaccgcggatccgggctggatcaccggtatt
gcctacggcttcctggccccctggttgctggggattccggtggtggtgcgggggggccgg
tttaatgccgaagactggtgcgccaccctggccaaataccgggtgtcggtgtggtacagc
gcccccacggccttccgcatgatcatgtccggcggcgatgagctcttgtcccggtacgac
ttaagccgcctgcgccacattttgagtgtgggtgaacccctcacggaagaggtcatggaa
tggagcctggccaagctggggcagcccatctacgacacctggtggatgagcgaaacgggc
atgaacatgatttgcaattaccgctgcatgcctatcaagattggctccattggccttccc
ttcccggggattgaagcggccgtggtggacgatgaaggccgggagttgcccccgggcagg
atcggcaacctggccatccgtgccggttggccggcccagatccgggcggtgtggaatgac
ccggcgcgttacgaggaatatttccgtcacaaaccctggtttatttccggtgacgctgca
tacagggatgaggatggctacttctatttccagggacgcctggacggtgtaatcaatacc
tccggtgagcgggtaggccccgcggaggtggaaagtaaactggaggaacacccggcagtg
gcccgggccggggtggccggaaagcccgacaaattgcggggggaaatcgtcaaggccttt
attgtcctcaatcccggttatacctggtcagacgagctggccgcggaactgcgtgagttt
gtcaagacgggcctggcggcccacgccgccccccgggagtttgaagtcaaggaatccatc
cccctgaccagggacggccgggtggatcgccgggtactgcgggaatgggtgctttttagg
caggatttttga

DBGET integrated database retrieval system