KEGG   Desulfotomaculum kuznetsovii: Desku_2231Help
Entry
Desku_2231        CDS       T01499                                 

Definition
magnesium chelatase (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
dku  Desulfotomaculum kuznetsovii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dku00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Desku_2231
Enzymes [BR:dku01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Desku_2231
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2222043..2223110)
Genome map
AA seq 355 aa AA seqDB search
MKYIYPFSAIVGQEEMKKGLLLNAVNPKLSGILIRGEKGTAKSTAVRALAALLPEIDVVA
DCPFSCDPDDITTMCMDCRQRLAAGEELPRARRKMRVVDLPVSATEDRVVGTLDIEQAIK
KGEKHFEPGVLAQANRGILYVDEVNLLDDHVVDVLLDSAAMGVNTVEREGVSFTHPAQFI
LVGTMNPEEGELRPQLLDRFGLCVHITGIMDPELRVEVIRRRAAFEEDPEGFTRQWEGEE
EKLRRQIVAAKKLLPEVEIPEEMLYLIAKIAIEMGVDGHRADLVMMKAAKTMAALAGRTE
VTRDDVHSSVNLALLHRMRRKPFQEMDIDREKLQVIMGGQKARHFHEHSHGHSHR
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatatctaccctttttcagccattgtcgggcaggaggaaatgaaaaaaggcttg
ttgttaaatgccgttaaccccaaactatctggtattctcatccggggtgaaaagggcacc
gccaaatcaaccgccgtacgggctctggcagcattattaccggagattgatgtggttgcc
gactgcccctttagctgtgaccccgatgatatcaccaccatgtgtatggactgccggcaa
cgccttgccgcgggcgaggaactgccccgggccaggcgaaaaatgcgggtggtggacctg
cccgtatctgccactgaagaccgggtggtggggacgctggacattgagcaggccatcaaa
aaaggagaaaagcacttcgaaccgggtgttctggcccaggccaaccggggtattctttat
gtggatgaggtaaaccttttagacgatcacgtggtcgatgtgttgctggattccgcagct
atgggagtaaacactgtggagcgggaaggggtttccttcacccacccggcacaatttatt
ctggtgggcaccatgaatccggaggaaggtgaactgagaccccagttgctggaccgtttc
ggcctttgtgtacatatcaccggtattatggacccggagctgcgggtggaggtgatcagg
cgccgggctgcttttgaagaagatcccgaagggtttaccaggcagtgggagggggaagaa
gaaaagttacgccggcaaatcgtggcggctaaaaaactgctgccggaagtagaaatcccg
gaggaaatgctttatctgatcgcaaagatagccattgaaatgggtgtggacggccaccgg
gccgatctggtgatgatgaaggcggccaagaccatggccgccctggccggccgtaccgag
gttacccgcgatgatgtgcacagttcggtgaaccttgccctgctccaccgcatgcgccgc
aagcctttccaggaaatggatatcgatcgggagaaactgcaggtgatcatgggtggacaa
aaagcccgccattttcacgaacattcccacgggcacagccatcgttaa

DBGET integrated database retrieval system