KEGG   Desulfotomaculum kuznetsovii: Desku_2553Help
Entry
Desku_2553        CDS       T01499                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
dku  Desulfotomaculum kuznetsovii
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:dku00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2537870..2539021)
Genome map
AA seq 383 aa AA seqDB search
MKEIVILGSTGSIGRQALDVIRRFPDKMRVAGLAAGSNWPLMAEQIREFRPRVVALAREE
AARELAQNLPPEELPDIFWGPGSLVTVATAVDSGVVLNALTGTVGLGPTVAALEKGLDIA
LANKETLVAAGELVMKLAREKGARILPVDSEHSAIWQCLAGQPQNRVGKIILTASGGPFR
KEPADLSRVTVDEALAHPNWRMGKKITIDSATLMNKGLEVLEAHWLFAVDYDQIEVVVHP
QSIIHSMVEFVDGSVIAQLGLPDMRLPIQYALSYPDRWPSELPRVDWFALGELTFEPPDT
KRFPCLALAYAAGRTGGTMPAVLNAANEIAVDAFLAGEIDFTAIPRLVAGVMEEHAVVYE
PTLEEILAADQWARGAAREKARR
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagattgtcatcctcggcagcaccggttccattggccggcaggctctggacgtg
atcaggcggtttcccgataaaatgcgtgtggccggcctggccgccgggagcaactggccc
cttatggccgaacagatccgggaattccgcccccgggtggttgccctggcccgggaggaa
gcggcccgggaactggcccaaaacctcccccctgaggaattgcctgatattttctggggc
cccgggagtctagtgaccgtggcgaccgccgttgatagcggggtggttttaaacgccctc
acaggaaccgtggggctgggtcctacggtggcggcgctggaaaaggggctggatattgcc
ctggccaacaaggaaacactggtagccgcgggtgagctggtcatgaagcttgcccgggaa
aagggagcccgtattttaccggtggatagcgagcattcggccatctggcagtgtcttgcc
ggccagcctcaaaacagggtgggtaagattatccttacggcttcgggggggccctttcgc
aaagaacccgccgatctttcccgggtcacggtagacgaggctctggctcatcccaactgg
cggatgggaaagaagattaccatagattcggctaccctgatgaataaggggctggaagtc
ctggaagcgcactggctttttgccgtggattatgatcaaatagaagtggtggtccatccc
cagagcattatccactcgatggtggaatttgtcgacggttcggtcatagctcagctgggc
ctgccggacatgcgcctacccatccagtacgcactttcttaccccgaccgctggcccagt
gaattgccccgggtggactggtttgctttaggcgaactcacctttgaaccgccggacacc
aagcgctttccctgtctggccctggcctacgccgccggccgcaccggcgggaccatgccg
gcagtgcttaatgccgccaatgagattgccgttgatgctttcctggccggggaaattgat
ttcaccgccataccccggcttgtggccggagtcatggaggagcacgcggtcgtttacgag
cctactttagaagagattctggccgcagaccagtgggcccgcggggcagcgcgggaaaaa
gcaagaaggtga

DBGET integrated database retrieval system