KEGG   Desulfotomaculum kuznetsovii: Desku_2801Help
Entry
Desku_2801        CDS       T01499                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
dku  Desulfotomaculum kuznetsovii
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:dku00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Desku_2801
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Desku_2801
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Desku_2801
Enzymes [BR:dku01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Desku_2801
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2785714..2787219)
Genome map
AA seq 501 aa AA seqDB search
MLYQSTRGNSQPVSAAGAIKLGIAPDGGLFVPDRPVFVTAGELALMAGMTYQERAASILQ
LFLTDFTSGEIRECVQGAYDREKFDVPEVAPLQKLDEHLYVLELWHGPTCAFKDMALQIL
PRLLPRAVKKTGEDREIAILVATSGDTGKAALEGFRDVPGTRIIVFFPARGVSEVQRLQM
ITQEGRNVHVVAVEGNFDQTQSGVKAIFTDPAVNAAIDRRGYRFSSANSINWGRLVPQIV
YYFSAYADLLARGEIASGETVNFVVPTGNFGNILAAFYARRMGLPVKRLICAANRNNVLT
DFIRTGTYDRTREFYRTISPSMDILISSNLERLLYEVTGGDAARVREWMGALQTAGRYQV
DGETLEKIQAVFWSDFAGDPATMETIRNTYRQYGYLMDTHTAVGKYVYDRYVEATGDTGK
TVIASTASPFKFNQSVATAILGEEAVRGKGEFELLETLSRATGLPIPKGLKNLDKKPVRH
TLTVAPEEMKRVVQELLTGRN
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgttataccagagtaccaggggaaatagccagccggtgagtgccgccggagccatcaag
ctgggcattgctcccgacggggggctgtttgtgcccgaccgcccggtttttgtgaccgcc
ggcgagctggccttgatggccggaatgacttaccaggaacgggcggcaagcatactgcaa
ttgtttcttactgacttcacctccggtgaaatcagggaatgcgtacagggagcctacgac
cgggaaaagtttgacgtgccggaagttgccccgctgcaaaaactggatgaacacctgtac
gtgctcgagctgtggcacggccccacctgcgccttcaaggatatggccctgcaaatactg
ccccggcttttgccccgggcggtaaaaaagacgggtgaagatagggaaattgccatcctg
gtggccacctccggcgatacgggtaaggccgccctggaaggtttccgggatgtgcccggt
acccgtatcattgtcttttttccggcccggggggtcagtgaagtacagcgcctgcagatg
atcacccaggagggccgcaatgtccacgtggtggcggtggagggcaactttgaccagacc
cagagcggggtgaaggcaatttttaccgaccccgcggtaaatgcggccattgaccgccgg
ggctaccgcttttcttcagccaattccattaactgggggcgactggtgccccaaattgtt
tattatttttcagcctatgcggatttgctggccagaggggagatcgcttccggcgaaacc
gtgaacttcgtggtgcctacaggtaacttcggcaatatcctggccgccttttatgcccgg
cggatggggctgccggtcaaacggcttatctgtgcagccaaccgcaacaatgtgttgacg
gactttatccgcacgggcacctacgaccgcaccagggaattttatcgcaccatctcccct
tccatggatatcctcatttccagcaacctggagcgtctgctttatgaggttaccggtggt
gatgccgcgcgggtgcgggagtggatgggggcgctgcaaactgcagggcgctaccaggtg
gacggtgaaacgctggaaaagatccaggccgttttctggtccgattttgccggtgacccg
gccaccatggagaccatccgcaatacttaccggcagtatggttacctgatggatacccat
accgccgtgggcaagtatgtttatgaccgctacgtcgaggctaccggggataccggtaaa
acggtaattgcctccacggccagtccctttaagttcaatcaaagcgtggccacggccatc
ctgggggaagaggcggtacggggaaaaggggaattcgagctgctcgagaccctgtcccgg
gctaccgggctgcccatacccaaagggttaaagaacctggataaaaaaccggtgcgccat
actttgaccgtggcaccggaggaaatgaaacgggtggtgcaggaacttttaaccgggcgc
aactag

DBGET integrated database retrieval system