KEGG   Desulfotomaculum kuznetsovii: Desku_3081Help
Entry
Desku_3081        CDS       T01499                                 

Definition
(GenBank) Aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
dku  Desulfotomaculum kuznetsovii
Pathway
dku00030  Pentose phosphate pathway
dku01100  Metabolic pathways
dku01120  Microbial metabolism in diverse environments
dku01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dku00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Desku_3081
Enzymes [BR:dku01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Desku_3081
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: AEG16576
JGI: Desku_3081
UniProt: F6CLF8
Position
complement(3089201..3090961)
Genome map
AA seq 586 aa AA seqDB search
MRGFYGRLLRIDLSTRHWQAEEIPDEVLAAYLGGKGLGTYLMLQNIPPGADPLGPENCLI
FTTGPVTGTAMPGSNRFGVFARSPLTGFYGESYSGGHVGAAMKRTGYDAIIIQGQAKNPT
LLEVTDQGVSFRDGTKLWGLDCYAAEDGALAEVGARGAQAVVIGPAGENLVRYACIENNY
WRSAGRTGMGAVMGSKKLKAVVFHGRAGCELADPAGLKQYVTGLTQKARDNAGVLGYRKY
GTPQLVSIMNSVGAFPARYWSRGTLPGWESLTGDYLIENFEVQPRACRPCLMTCGNLTRV
TRGRHEGLMVEGPEYETIYSFGGLCCIHDLAEIIYLNDICDRLGLDTISAGNMAAFAIEA
AQRGALDVKVAYGDVEGIAQLLHQIARREGVGDLLAEGIRAAAEKLGLSDLAIHVKGMEP
AGYDPRVLQGMGLAYATSPRGACHLRATFYKPELAGIIDPKTTHGKAELFIDYEDRLAIY
DALILCRFYRDLVLWGDLVILVNATTGLGVDEGQLRRIAGRIVAATRQFNLLQGLTRDDD
NLPPRFFKEPLENGDVLPEENFKQMLADYYRLRGWDEKGCPLVGAI
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgagaggcttttatggacggctgctccgcattgacctgtcaaccagacattggcaggcg
gaggaaattccagatgaagttttggctgcatacctgggcggtaaaggtttgggcacttac
ctcatgctccagaacattccgcccggggccgaccccctgggtccggaaaactgcctgatt
tttaccaccggccctgtaacaggtacggccatgccgggttccaaccgttttggagtcttt
gcccggtcccccctcaccggtttttacggcgagtcctactcgggcggccatgtgggggcg
gcaatgaagagaaccggttacgatgctattatcattcagggccaggcaaaaaatcctacc
ttattggaagtcaccgatcagggtgtttctttccgggacggtacgaaactgtggggcctg
gattgttacgctgctgaagatggggcactggcggaggttggcgcaaggggcgcccaggcg
gtggtgatcggtccggccggcgaaaacctggtccgctatgcctgcattgaaaacaactac
tggcgttccgcgggacggaccggcatgggggccgtgatggggtcgaaaaaactaaaggct
gttgtttttcacggccgggccggctgtgagctggccgacccggcgggtctgaaacaatat
gtcaccgggctgactcaaaaggccagggacaacgctggggtgcttggctaccgcaagtac
ggtacaccacagctggtttcgataatgaactcggtaggcgcctttccggccaggtactgg
tcccggggaacccttcccggctgggagtcactgaccggcgactacctgatcgaaaacttt
gaagtgcaaccgcgggcctgccgcccctgcttaatgacctgcggcaacctcacccgggtg
acgaggggaaggcacgaagggcttatggtggaaggtccggaatatgaaaccatttattct
ttcggcggattgtgctgcatccacgacctggccgaaatcatttacctgaacgacatttgc
gaccggcttggcctggatacaatcagtgcgggcaacatggcggcctttgccatagaggcg
gcacaaagaggagcactggacgttaaagtggcttacggggacgtagaaggtattgcgcag
ctactccaccagatagcccggcgggagggcgtgggtgacctgctggccgaaggtatccgg
gcggcggcggaaaaactgggcctttccgacctcgccatacatgttaaagggatggaaccg
gccggctatgatccccgggtgttgcagggcatgggcctggcctacgccacctctccccgg
ggtgcgtgccatctgcgcgctacattttacaagcccgaactggccgggatcatcgatccg
aaaaccactcacgggaaagcagagctgttcattgattatgaggaccggttggctatttac
gacgcccttattctctgccgtttttaccgggacctggttttatggggggacctggttata
ctggttaacgccaccacgggcctgggtgtggacgaaggacagctgcgccgcattgccgga
cgcatagttgcggccacccgtcaatttaaccttttacagggcttgaccagggatgacgat
aacctgccgccacgcttctttaaagaaccgctggaaaacggggacgttctcccggaagaa
aacttcaagcagatgctggccgattactaccgcctgcgcgggtgggatgaaaaaggatgc
ccactcgttggcgctatttaa

DBGET integrated database retrieval system