KEGG   Desulfotomaculum kuznetsovii: Desku_3111Help
Entry
Desku_3111        CDS       T01499                                 

Definition
(RefSeq) Succinate--CoA ligase (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
dku  Desulfotomaculum kuznetsovii
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dku00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Desku_3111
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Desku_3111
   00640 Propanoate metabolism
    Desku_3111
   00660 C5-Branched dibasic acid metabolism
    Desku_3111
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Desku_3111
Enzymes [BR:dku01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Desku_3111
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3122638..3123876)
Genome map
AA seq 412 aa AA seqDB search
MARLFEYQGKELLKECGIPVPRGRLAGTPAEAREVAAELGKPVVIKAQAWVTGRAEAGGI
KFADSPGEAAMHAEAILGLQLKGFRVEKVLVEEKLDVAEQFYAGVIVSDQYRSPVMMFST
MGGTGIEEIARAHPDKVWRLPVDIFTGLREHEARNLVRRAGIRGKLQAKLVQVLVKLYRL
ARKVEARSLEINPLVLDRSGEIYAADCRVTVDDNAVFRHPELGIEIAREFDRPATPLEKI
AYKVEEKDYRGTFYFLQLETQYEDEGYIGFHGGGGGGSMMAMDALMRAGFKLANFCDTSG
NPPASKVYRAAKIILSQPKLEGYFHSGSGVASQEQYHTARGMVKAFREVNLSIPAVIRIG
GNSEEEAIRILTEYTRDLPGKVEAYGRDVPVEYCVKRLKELIAENKARKAVS
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atggccagacttttcgaataccaggggaaagaactgttaaaagaatgcggcattcccgtg
ccgcggggccggctggctggaacgccggcagaagccagagaggttgcggccgaactcggt
aagcccgtagtcatcaaggcacaagcctgggtaaccggcagggcggaggccggaggaatt
aaatttgccgattcgcccggggaagccgcgatgcacgctgaggccatactggggcttcag
ttaaaaggatttcgcgtggaaaaggttctggtggaagaaaagctggacgtagcagaacaa
ttttatgctggtgtaattgtaagcgaccagtaccgttccccggtaatgatgttcagcacc
atggggggtaccgggatcgaggaaattgcccgggcgcacccggataaggtctggcggttg
ccggtggatattttcacgggcctgagggagcacgaagcgcgcaacctggtccgcagagcg
gggatcaggggtaagttgcaggccaagctggtccaggtgctggtcaagctttaccggctg
gcccggaaagtggaggccaggtccctggagattaatcccctggtcctggatcgctccggg
gaaatatacgccgctgactgccgggtgacggtggatgataatgccgtctttcgccatccg
gaactgggcatcgaaatcgcccgggagtttgaccggccggcgaccccgctggaaaagata
gcctacaaggttgaagaaaaggattaccgggggactttttacttcctgcaactggaaacc
cagtatgaagatgagggttatatcggtttccacggcggcggtggcggtggttccatgatg
gccatggatgcactgatgcgggcggggttcaagctggccaatttctgtgacaccagcggc
aacccgccggcttccaaggtgtaccgggcggctaaaattattttgtcccagccaaaactg
gaagggtatttccattccgggtccggtgtggccagccaggagcaataccacacggccagg
ggaatggtgaaggccttccgggaagttaacttgagtataccggcggtaatcaggatcgga
ggtaactcggaagaagaagccatccgcattctgacggagtacacccgggacctgcccggg
aaagttgaagcttacgggcgggatgtgccggttgagtattgtgtaaaaaggcttaaagaa
ctgattgcggaaaataaggccagaaaggcggtgtcatga

DBGET integrated database retrieval system