KEGG   Desulfotomaculum kuznetsovii: Desku_3111Help
Entry
Desku_3111        CDS       T01499                                 

Definition
(GenBank) Succinate--CoA ligase (ADP-forming)
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
dku  Desulfotomaculum kuznetsovii
Pathway
dku00020  Citrate cycle (TCA cycle)
dku00640  Propanoate metabolism
dku00660  C5-Branched dibasic acid metabolism
dku00720  Carbon fixation pathways in prokaryotes
dku01100  Metabolic pathways
dku01110  Biosynthesis of secondary metabolites
dku01120  Microbial metabolism in diverse environments
dku01130  Biosynthesis of antibiotics
dku01200  Carbon metabolism
Module
dku_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dku00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Desku_3111
   00640 Propanoate metabolism
    Desku_3111
   00660 C5-Branched dibasic acid metabolism
    Desku_3111
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Desku_3111
Enzymes [BR:dku01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Desku_3111
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 ATP-grasp_5 Citrate_bind GARS_A CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: AEG16605
JGI: Desku_3111
UniProt: F6CLI7
Position
complement(3122638..3123876)
Genome map
AA seq 412 aa AA seqDB search
MARLFEYQGKELLKECGIPVPRGRLAGTPAEAREVAAELGKPVVIKAQAWVTGRAEAGGI
KFADSPGEAAMHAEAILGLQLKGFRVEKVLVEEKLDVAEQFYAGVIVSDQYRSPVMMFST
MGGTGIEEIARAHPDKVWRLPVDIFTGLREHEARNLVRRAGIRGKLQAKLVQVLVKLYRL
ARKVEARSLEINPLVLDRSGEIYAADCRVTVDDNAVFRHPELGIEIAREFDRPATPLEKI
AYKVEEKDYRGTFYFLQLETQYEDEGYIGFHGGGGGGSMMAMDALMRAGFKLANFCDTSG
NPPASKVYRAAKIILSQPKLEGYFHSGSGVASQEQYHTARGMVKAFREVNLSIPAVIRIG
GNSEEEAIRILTEYTRDLPGKVEAYGRDVPVEYCVKRLKELIAENKARKAVS
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atggccagacttttcgaataccaggggaaagaactgttaaaagaatgcggcattcccgtg
ccgcggggccggctggctggaacgccggcagaagccagagaggttgcggccgaactcggt
aagcccgtagtcatcaaggcacaagcctgggtaaccggcagggcggaggccggaggaatt
aaatttgccgattcgcccggggaagccgcgatgcacgctgaggccatactggggcttcag
ttaaaaggatttcgcgtggaaaaggttctggtggaagaaaagctggacgtagcagaacaa
ttttatgctggtgtaattgtaagcgaccagtaccgttccccggtaatgatgttcagcacc
atggggggtaccgggatcgaggaaattgcccgggcgcacccggataaggtctggcggttg
ccggtggatattttcacgggcctgagggagcacgaagcgcgcaacctggtccgcagagcg
gggatcaggggtaagttgcaggccaagctggtccaggtgctggtcaagctttaccggctg
gcccggaaagtggaggccaggtccctggagattaatcccctggtcctggatcgctccggg
gaaatatacgccgctgactgccgggtgacggtggatgataatgccgtctttcgccatccg
gaactgggcatcgaaatcgcccgggagtttgaccggccggcgaccccgctggaaaagata
gcctacaaggttgaagaaaaggattaccgggggactttttacttcctgcaactggaaacc
cagtatgaagatgagggttatatcggtttccacggcggcggtggcggtggttccatgatg
gccatggatgcactgatgcgggcggggttcaagctggccaatttctgtgacaccagcggc
aacccgccggcttccaaggtgtaccgggcggctaaaattattttgtcccagccaaaactg
gaagggtatttccattccgggtccggtgtggccagccaggagcaataccacacggccagg
ggaatggtgaaggccttccgggaagttaacttgagtataccggcggtaatcaggatcgga
ggtaactcggaagaagaagccatccgcattctgacggagtacacccgggacctgcccggg
aaagttgaagcttacgggcgggatgtgccggttgagtattgtgtaaaaaggcttaaagaa
ctgattgcggaaaataaggccagaaaggcggtgtcatga

DBGET integrated database retrieval system