KEGG   Desulfotomaculum kuznetsovii: Desku_3144Help
Entry
Desku_3144        CDS       T01499                                 

Definition
glutamyl-tRNA synthetase (EC:6.1.1.17)
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
dku  Desulfotomaculum kuznetsovii
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:dku00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    Desku_3144
Enzymes [BR:dku01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     Desku_3144
Amino acid related enzymes [BR:dku01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   Desku_3144
Transfer RNA biogenesis [BR:dku03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Desku_3144
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3155739..3157187)
Genome map
AA seq 482 aa AA seqDB search
MSGVRVRFAPSPTGPLHIGGARSALFNWLFARNQGGTFIVRIEDTDLERSSRESEENILA
ALRWLGLDWDEGIEVGGPHGPYRQTERLPIYQRYARQLLESGWAYRCYCTEEELAAEREA
LLARGEMPRYSGRCRHLCEEDRRRLEAEGRRPVLRFAVPSGETITVQDLVRGEVSFDVDG
IGDFIIVKSDGIPTYNFAVVVDDHTMGITHVIRAEEHLSNTPRQILLYRAFGWPVPQFAH
VSLILGQDRTKMSKRHGATSIEQYREMGYLPEALVNFLALLGWSPGGEEEIFTLEELKRQ
FSLERVAKNPAVFDLDKLNWLNGHYIRQSPLERITDLAIPFLQKAGYISGEVTPEQYQWL
KQLVAAVRDYLTNLSGITRHVDIFFAPEVEPEDEEARAVLAGEQVPRVLAALAEKIRSAD
GLNEETARSMLKKLPKELGLGARKVYLPIRVALTGRTHGPELFQVIPLLGKEKVLARLAR
AG
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
ttgtccggcgtcagagtaagatttgcccccagccccaccggcccgctgcatatcggaggg
gctcgttcggctttgtttaactggctgtttgcccgcaatcaaggcggcacttttattgtg
cgcatcgaggacacggatctggagcgttcttcccgggaatccgaggaaaacatcctggcc
gctttgcgctggctgggcctcgattgggacgaggggattgaagtgggcggtccccacggc
ccttaccggcagacggagcggcttcccatttatcaacgttatgcccggcagcttttagaa
agcgggtgggcctaccgctgttactgtaccgaagaggagctggccgccgagcgggaagcc
cttttggcccggggcgagatgccccgctatagcggccgatgtcgtcacctgtgcgaggag
gacaggcgccgtttggaagccgaggggcgccggccggtactgcgtttcgcggtcccctcc
ggggaaaccataaccgtgcaggacctggtccgcggggaagtatcctttgatgttgacggc
atcggcgactttattatcgttaagtccgacggcattcccacctacaactttgccgtggtg
gtggatgatcacaccatgggcattacccatgtcatccgggcggaggaacacctgtccaat
acgccgcggcagattctcctttaccgggccttcggctggccggtgccgcagtttgcccac
gtttcgctgatcctgggccaggatcgcaccaagatgagcaagcggcacggagccacttcc
atcgagcagtaccgggagatgggctaccttcccgaggccctggtcaacttcctggccctt
ttaggctggtcccccggcggcgaagaggaaatctttactctggaagagttaaaacggcag
ttttccctcgagcgggtggccaaaaatccggccgtttttgacctggacaagcttaactgg
ttgaacggccactacattcgtcaaagccccctggagcggattaccgatctggccataccc
tttttgcaaaaggccggttatatttcaggcgaggtaactccggagcagtaccaatggttg
aaacaactggtggcggccgtacgggattacctgaccaacctgtccgggattacccggcac
gtggacattttctttgcgccggaagtggagccggaagatgaagaggcccgcgctgtgctg
gccggggagcaggttccccgcgtcctggccgccctggcggagaaaatcagatcggcagac
ggattgaatgaagaaactgcccggagcatgttgaaaaagctgcccaaggaactgggtttg
ggcgcccgcaaagtttacctgcccatccgggtggccctcaccggccggacccatggcccg
gaacttttccaggttatccccctcctgggcaaggaaaaggtgctggcccgcctggcccgg
gcaggttaa

DBGET integrated database retrieval system