KEGG   Desulfotomaculum kuznetsovii: Desku_3248Help
Entry
Desku_3248        CDS       T01499                                 

Definition
succinate dehydrogenase membrane subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
dku  Desulfotomaculum kuznetsovii
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:dku00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Desku_3248
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Desku_3248
   00650 Butanoate metabolism
    Desku_3248
  Energy metabolism
   00190 Oxidative phosphorylation
    Desku_3248
   00720 Carbon fixation pathways in prokaryotes
    Desku_3248
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3267498..3267821)
Genome map
AA seq 107 aa AA seqDB search
MLSGWTWLFQRITAFFLILVLGVHFWILHYQNPGEILVYADAARRLQTALFLTVDSLLLA
FGLFHALNGLHNVLEDFNVRSRSITFVLLLVGVGLFIMGIYSLWQFV
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atgttgagcggatggacatggctctttcagcgcataaccgctttctttttaattctggtg
ctgggggtgcacttctggatcttgcattatcagaatcccggtgaaatcctggtctatgcc
gatgcagcccggcgactgcagacggcgttgttcttaacggtggattcccttcttttggcc
ttcggattatttcatgcgcttaatgggttgcacaacgttctggaagattttaacgtaaga
tcccgttcgataaccttcgtgttgctgctggtgggggtaggcctgtttattatgggcata
tattccctctggcagttcgtctaa

DBGET integrated database retrieval system