KEGG   Desulfotomaculum kuznetsovii: Desku_3293Help
Entry
Desku_3293        CDS       T01499                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dku  Desulfotomaculum kuznetsovii
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dku00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Desku_3293
   01230 Biosynthesis of amino acids
    Desku_3293
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desku_3293
   00051 Fructose and mannose metabolism
    Desku_3293
   00562 Inositol phosphate metabolism
    Desku_3293
Enzymes [BR:dku01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Desku_3293
Exosome [BR:dku04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Desku_3293
  Exosomal proteins of bladder cancer cells
   Desku_3293
  Exosomal proteins of melanoma cells
   Desku_3293
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3310233..3310994)
Genome map
AA seq 253 aa AA seqDB search
MRIPLLAGNWKMYKTVTEAVEFVRGLKEALAGVQGVEVAVCPPFTALYAVARELEGSNIV
LGAQNMHRAEEGAYTGEISPVMLKEIGCRYVILGHSERRQYFGESDEDVNAKVKAALKHG
LVPIVCVGERLEEREAGHTERVVGAQVRRSLAGLSGTELAGLVVAYEPVWAIGTGRTASP
EDAQQVNAFIRCLLAEMGGQEAARQVRIQYGGSVKPENAAELLGQPDIDGALVGGASLKV
DSFGAIVRAALRE
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcgtataccccttctggcgggtaactggaaaatgtataagaccgtcaccgaagcggta
gaattcgtgcgggggctaaaagaggccctggccggcgtccagggggtggaggtggccgtc
tgtcccccctttaccgccctgtacgccgtggcccgggaactggagggcagcaacatcgtc
ctgggcgcccagaatatgcaccgggccgaagaaggagcctatacgggggaaatttccccg
gtcatgttgaaggaaatcggctgccgctacgtgatcctgggccactcggaacggcggcag
tatttcggcgaaagtgatgaggatgtcaacgccaaggtaaaagcggcccttaaacacggg
ctcgttcccattgtttgcgtgggcgaacgcctggaggagagggaagcgggacatacggaa
agggttgtcggtgcacaggtgcgccgttcactggccggcctttccggcaccgagctggcc
ggcctggtggtggcctacgagccggtgtgggccatcggcaccggacgcacggcttcgccg
gaagacgcccagcaggtgaacgcctttatccgctgcctgctggccgagatggggggccag
gaggcggcccggcaggtgcgcatccagtacggtggcagcgttaagccggaaaatgccgcc
gaactgctggggcagcccgatatagacggcgccctggtgggcggcgccagcttgaaggtg
gacagctttggcgccattgtccgggcggcgctgcgggaatag

DBGET integrated database retrieval system