KEGG   Dehalogenimonas lykanthroporepellens: Dehly_0006Help
Entry
Dehly_0006        CDS       T01264                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
dly  Dehalogenimonas lykanthroporepellens
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:dly00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4502..5359
Genome map
AA seq 285 aa AA seqDB search
MKLTRHISELPPTTIGGVPFHWGCKTYIMGVLNVTPDSFSGDGLADDIDAAVVRARQLVD
QGADIIDVGGESTRPGAPEVGEDEEIHRVVPVIGRLKAELNIPVSVDTYKHRVAEEAALA
GADMINDVWGLKRDVGVARIAAEYNLPLIVTASQRDRRVKNIIPAVLRHLRWAIVKAEGF
GVSPDNIIVDPGFGFGKSVEQNLEVVRQLFRLKVLGKPILLGASLKSTIGRVLGDVPPSQ
RLEGTLAAHVVGIVGGADIIRVHDVEAHARAARVTDAIMRGWVDD
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgaccaggcatatttcagaattacctcccaccaccatcggcggagttcctttt
cactggggttgtaaaacttatatcatgggtgtactcaacgtcacgcccgattctttttcc
ggtgacggcttggccgacgatatcgacgccgccgttgtccgggccaggcaattagttgat
cagggcgcggatatcatcgatgtcggcggggaatccactcgcccgggcgctcccgaagtc
ggggaagatgaggaaatccatcgggtggtgccggtcatcggacgtctgaaagcggaatta
aatattcccgtcagtgtcgatacttacaagcacagggtagctgaagaagcggcattggcc
ggagccgacatgatcaacgatgtctggggtttgaaaagagatgtgggtgtcgcccggata
gcggctgaatataaccttccactgattgtgactgcttctcaacgtgacaggcgggtaaaa
aacataattcctgcggtcttacgacacctgcggtgggctatcgtaaaagcagaaggtttc
ggagtatctcctgataatattatcgttgatcccggattcggattcggtaaatcggtagaa
cagaatctggaagttgtccgtcaacttttccgtctgaaggtactgggcaagccgatattg
ttgggggcgtcactgaaatctacaattggcagagtcctgggggatgttccgccgtcccaa
cgtctggagggcacactggcggcacatgtcgttggtatcgtcggaggcgccgacatcatc
cgggtgcatgacgtcgaagcccatgccagagcggctcgggtgacggatgccatcatgaga
ggttgggtcgatgactga

DBGET integrated database retrieval system