KEGG   Dehalogenimonas lykanthroporepellens: Dehly_0308Help
Entry
Dehly_0308        CDS       T01264                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
dly  Dehalogenimonas lykanthroporepellens
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:dly00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dehly_0308
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Dehly_0308
Enzymes [BR:dly01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Dehly_0308
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(287380..288498)
Genome map
AA seq 372 aa AA seqDB search
MNAELNYRRVVIKLGTNLLTGGSGRLDQLVMGELVAQVARLAQAGVEVAVVSSGAIAAGK
EKLGLYKKLRDMPYRQILASVGQSRLMNVYDGLFGAHGLTVAQALLTRTDLNDRSGYLNA
RNTLLALMELRVIPIVNENDVVAVDEIEEAKFGDNDNLSAMVANLIDADLLLMLSDIDGL
YTGNPLKDKSAQLVPLVEKITPEIEALAGGTWSEAAVGGMVTKIEAARLATASGVRVVIA
AGREPDIITRIMSGSADGTHFLPAGEPDSRRRWLLSGLSVRGKVIIDEGAARAVGRCGSL
LPAGIREAEGNFKRGDIIRIIGPEGRLLGYGIANYDAADMNAVRGLHSGKIAETLGRSYG
AEAIHRNNLVIC
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcagaactgaattaccgccgggttgtcatcaagctgggcaccaacctcctgacc
ggaggcagtggccggctggatcaactggtcatgggagaactggtggcccaggtggcccgg
ctggctcaggccggggtggaggtggcggtggtcagttccggcgccattgccgccggcaag
gaaaaactggggctgtacaagaagctccgcgatatgccgtaccgtcagattctggcttcg
gtaggccagtcacggctgatgaatgtctatgacggactgttcggcgctcacgggctgacg
gtagcccaggctctcctgacccgcaccgacctcaacgaccgctccggttacctgaacgcc
cgcaacaccctgctggcgctgatggagctgagggtcatccccatcgtcaacgaaaacgac
gtggtggccgtggacgagatagaggaagccaagttcggcgacaatgacaacctttcggcc
atggtggccaacctcatcgacgccgatttgctgttgatgctgtccgacatcgacgggctg
tacaccggcaacccgctcaaggacaaaagcgcgcaactggtgccgctggtggagaaaatc
accccggagatagaagccctggccgggggcacctggagcgaggcggcagtgggcggcatg
gtgaccaagatagaggcggcgcggctggcgacagcctccggtgtacgcgtggttatcgcc
gccggccgggagccggatatcatcacccgtatcatgtccggttcagctgacgggacgcat
ttcctgcccgccggagaacccgactcacggcgacgctggctgttgtccgggctgtcggtg
cgggggaaggtcatcattgacgaaggggcggcgcgcgccgtcggccgttgcggcagtctg
ctgccagccggcatcagggaagcagaaggtaatttcaagcgcggcgatatcatccgcatc
atcggccctgagggccggttgctgggctacggcatcgccaattacgacgcggcggacatg
aacgccgtccgcggcctgcattccggcaagatagccgagacactgggccgcagttacggg
gcggaggccatccaccgcaataatctggttatctgttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system