KEGG   Dehalogenimonas lykanthroporepellens: Dehly_0497Help
Entry
Dehly_0497        CDS       T01264                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
dly  Dehalogenimonas lykanthroporepellens
Pathway
dly00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dly01100  Metabolic pathways
dly01110  Biosynthesis of secondary metabolites
dly01130  Biosynthesis of antibiotics
dly01230  Biosynthesis of amino acids
Module
dly_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dly00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Dehly_0497
Enzymes [BR:dly01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Dehly_0497
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ADJ25810
UniProt: D8JZN2
Position
465975..466763
Genome map
AA seq 262 aa AA seqDB search
MLDKLTAAARVATERRRRLVPEAELVRQAEACPVPPDFRQALLGQGVAVIAEVKKASPSR
GVIRPDFDPVAIGLDYAESGADAISVLTEEEYFLGSPEYLKRIALATGGQRMPLLRKDFI
TEDYQVYEARAWGAGAVLLIASILEASRLKSLLALSRELGLAALVEVHDEAETGRAVEAG
AGIIGINNRDLKTFQVDIKTTERLRPLVPADRLVVAESGITGREDVVYLDGLGIDAVLVG
EALMRGLPLRELRLDEPGRGNQ
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgctggataaactgacggcggcggcgcgggtagcgaccgaacgacgccgccgactggta
ccggaggctgagttggtcagacaggcagaggcttgcccggtaccgccggatttccggcag
gcgctccttggacagggggtagccgttatcgccgaagtcaagaaggcttcaccgtcccgg
ggtgttatccgaccggacttcgacccggtggccatcggtctcgattacgccgaaagcggc
gccgatgccatttcggtgctgaccgaggaggagtactttctgggcagtcccgaatacctg
aaacggatcgcgctagctaccggcggtcagcggatgccgctgttacgcaaggattttatt
accgaagactatcaggtgtacgaagcccgggcctggggtgccggagcggtgttgttaatc
gccagcatcctggaagcgtcccggttgaaatcattgctggcgctgagccgggagttgggg
ctggcggcgctggtggaggtccatgacgaagccgaaaccgggcgggcggtggaggccggc
gccgggattatcggaatcaacaatcgtgatttgaagacgtttcaagttgacataaaaacg
acggaaaggctccggccgctggtgccggctgaccggctggtggtggctgaaagcggcatc
accggacgggaagatgtggtttacctggacgggttgggcatcgacgcggtgctggtgggt
gaagcgctgatgcggggtttgccgctcagggaactgaggctggacgaaccggggcggggt
aatcaatga

DBGET integrated database retrieval system