KEGG   Dehalogenimonas lykanthroporepellens: Dehly_0500Help
Entry
Dehly_0500        CDS       T01264                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
dly  Dehalogenimonas lykanthroporepellens
Pathway
dly00260  Glycine, serine and threonine metabolism
dly00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dly01100  Metabolic pathways
dly01110  Biosynthesis of secondary metabolites
dly01130  Biosynthesis of antibiotics
dly01230  Biosynthesis of amino acids
Module
dly_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dly00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dehly_0500
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Dehly_0500
Enzymes [BR:dly01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Dehly_0500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB
Motif
Other DBs
NCBI-ProteinID: ADJ25813
UniProt: D8JZN5
Position
468593..469381
Genome map
AA seq 262 aa AA seqDB search
MMSALSEVFGRAGCKALIGYLTVGYPDLATTLRAVEVLEKAGCDVVELGIPFSDPIGDGP
VIQSASFRALENGVTPQDCIETARQLRRTVRLPLVFMGYYNPVLSYGPVAFCRSAAEAGV
NGLIVPDLPPEESGVLSEAARDAGLDLVHLLAPTSTAERVATVARQSRGFIYLVSVAGVT
GTRSGVPDYLPEFIGRVRSATSQPLAVGFGVSTPEQAEAMAAHANGVIIGSQLIRLIDED
PSLGKLAEFIRATRRALDGVKD
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgatgagcgcgctgagcgaggtcttcggccgggccggatgcaaggctctgataggttat
ctgaccgttggttaccccgacctggcgacgacactccgggcggtggaggtactggaaaag
gcgggttgcgatgtggtggagctggggattcccttttccgaccccatcggtgacgggccg
gtcattcagtcagccagtttccgggcgctggagaacggcgtgacaccgcaggactgcatc
gaaacggcgcgacaactccggcggacagtacggttgccactggtcttcatgggttattac
aatccggtgctgagttacgggccggtagccttctgccggagcgccgctgaagccggggtt
aacggcctgattgtacccgacctgccgccggaggagtccggcgtgttgtccgaagccgcc
cgcgacgccggactggacctggttcatctgctggccccgacttctactgccgaaagagtg
gcaacggtggccagacagagccggggattcatctatctggtatcggtagccggcgtcacc
ggcacccgttccggggtgccggactacctgccggagttcatcggccgggtccgatcagct
acttcccagccgctggcggtgggattcggcgtgtctacgccggaacaggctgaggctatg
gcggctcacgccaacggcgtcatcatcggcagtcagctcatccggttgatagacgaagac
ccgtcgctgggtaaactggcagaatttatcagggcgacgcggcgggctctggacggggtg
aaggactga

DBGET integrated database retrieval system