KEGG   Dehalogenimonas lykanthroporepellens: Dehly_0500Help
Entry
Dehly_0500        CDS       T01264                                 

Definition
(RefSeq) tryptophan synthase subunit alpha (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
dly  Dehalogenimonas lykanthroporepellens
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dly00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dehly_0500
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dehly_0500
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Dehly_0500
Enzymes [BR:dly01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Dehly_0500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
468593..469381
Genome map
AA seq 262 aa AA seqDB search
MMSALSEVFGRAGCKALIGYLTVGYPDLATTLRAVEVLEKAGCDVVELGIPFSDPIGDGP
VIQSASFRALENGVTPQDCIETARQLRRTVRLPLVFMGYYNPVLSYGPVAFCRSAAEAGV
NGLIVPDLPPEESGVLSEAARDAGLDLVHLLAPTSTAERVATVARQSRGFIYLVSVAGVT
GTRSGVPDYLPEFIGRVRSATSQPLAVGFGVSTPEQAEAMAAHANGVIIGSQLIRLIDED
PSLGKLAEFIRATRRALDGVKD
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgatgagcgcgctgagcgaggtcttcggccgggccggatgcaaggctctgataggttat
ctgaccgttggttaccccgacctggcgacgacactccgggcggtggaggtactggaaaag
gcgggttgcgatgtggtggagctggggattcccttttccgaccccatcggtgacgggccg
gtcattcagtcagccagtttccgggcgctggagaacggcgtgacaccgcaggactgcatc
gaaacggcgcgacaactccggcggacagtacggttgccactggtcttcatgggttattac
aatccggtgctgagttacgggccggtagccttctgccggagcgccgctgaagccggggtt
aacggcctgattgtacccgacctgccgccggaggagtccggcgtgttgtccgaagccgcc
cgcgacgccggactggacctggttcatctgctggccccgacttctactgccgaaagagtg
gcaacggtggccagacagagccggggattcatctatctggtatcggtagccggcgtcacc
ggcacccgttccggggtgccggactacctgccggagttcatcggccgggtccgatcagct
acttcccagccgctggcggtgggattcggcgtgtctacgccggaacaggctgaggctatg
gcggctcacgccaacggcgtcatcatcggcagtcagctcatccggttgatagacgaagac
ccgtcgctgggtaaactggcagaatttatcagggcgacgcggcgggctctggacggggtg
aaggactga

DBGET integrated database retrieval system