KEGG   Dehalogenimonas lykanthroporepellens: Dehly_0595Help
Entry
Dehly_0595        CDS       T01264                                 

Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
dly  Dehalogenimonas lykanthroporepellens
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dly00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Dehly_0595
Enzymes [BR:dly01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Dehly_0595
Exosome [BR:dly04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dehly_0595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(557906..559822)
Genome map
AA seq 638 aa AA seqDB search
MNLPADKAFHDISLFGDVDYHLFNEGTHYRLKDKLGAHPAVRLGTPGWLFSVWAPAARDV
SVIGEFNAWRPGVHRLSRRGDSGIWEGFIPGIGCGVRYKYHLVPETPGRPFDKADPMALS
AETPPATASRTWQSAYSWQDGDWMKERWNRNRLDAPVSIYELHPGSWKRGAGDRLLNYRE
LAVLLVDYIGKTGFTHVELLPVMEHPFYGSWGYQITGYFAPTSRYGNPDDLKYLIDTLHQ
NGIGVILDWVPSHFPDDAHGLFRFDGTALYEHPDPRRGFHPDWDSCIFDYGRPEVRSFLI
SNALYWLDEFHADGLRVDGVASMLYLDYSRAPGQWQPNRKGGRENLEAMEFIRRLNTEIY
HRFPDVMSIAEESTAWPLVSRPVHGGGLGFGLKWDMGWMHDTLDYFSRDPLQRSQHHEKL
TFRSMYAFAENYVLPLSHDEVVHGKSALLAKMPGDDWQKFANLRLLYTYMWTLPGKKLLF
MGGEFGQWDEWQHDGSLDWRLLENDRHRSLSAMVEELNRLYRRLPALHRFDHAPEGFTWL
LPDDRARSVIAYRRSGQQPEDQAIIVLNLTPVPRPDYFVPLPEDGDWRIVFSSDNHRFGG
TGRPEYSRISGSGNTPASQSGVSLHLPPLGGIVLIPDS
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgaatctccctgctgataaggccttccacgacatcagccttttcggtgatgtcgactac
cacctgttcaatgaaggcacccactaccggctgaaggataaactgggagcccaccccgcc
gtcagacttggcacccccggctggctgttctcggtatgggcgcctgccgcccgggatgtt
tcggtcatcggtgaattcaacgcttggcgaccgggcgttcaccggctcagccgacgggga
gattccggtatctgggaaggtttcattcccggcatcggatgcggagtccgttacaaatat
cacctggtaccggaaactcccggccgtccattcgacaaggccgacccgatggctctgtct
gcggaaacacccccggccaccgcgtccagaacctggcagtcagcttactcctggcaggac
ggggactggatgaaggaacgctggaaccgtaacaggctcgatgccccggtgtccatctat
gaacttcatcccggctcctggaagaggggcgccggtgatcgtctgctgaactaccgggaa
ctggcggtgttgctggtggattatatcgggaaaaccggcttcacccatgtggaattactg
ccggtcatggaacatcccttttacggttcctgggggtaccagatcaccggttatttcgcc
ccgaccagccgctatggcaacccggatgacctgaagtatctcatcgacaccctgcaccag
aatgggatcggcgtcatcctggactgggtgccgtcccatttcccggatgatgcccacggc
ctgttccgcttcgacggcaccgccttatacgaacacccggacccccggcgcggcttccac
cctgattgggactcctgtatcttcgactatggccgccccgaagtccggtccttccttatt
tccaacgccctctactggctggacgaattccacgcagacggactgcgggtggacggggtc
gcctcaatgctgtacctggattattcccgcgcccccggccagtggcaacctaaccgcaaa
gggggccgggaaaacctcgaagccatggagttcatccgcagattgaatactgaaatatat
caccgtttcccggatgtaatgagcattgctgaagaatccaccgcctggccgttggtatcc
cgcccggttcacggcggcggcctcggcttcggcctgaaatgggatatgggctggatgcac
gatacgctggactatttttcacgcgacccgctccagcgttctcagcaccacgaaaaactg
actttccgtagcatgtacgctttcgccgaaaactacgttctgccactgtcgcatgatgaa
gttgttcatggcaagtcagccctgctggccaagatgcccggtgatgactggcagaaattc
gccaacctgcgactgctttatacttacatgtggaccctgcctggcaagaaactgctattc
atggggggggaattcggtcagtgggacgaatggcaacacgacggctcgctggattggagg
cttctcgaaaatgaccgtcaccgcagtctgtcggcgatggtcgaagaattgaacaggtta
taccgccgcctgccggccctgcaccggttcgaccacgccccggagggatttacctggctg
ttaccggatgatcgtgcccgaagcgtcatcgcctatcgccggagcggacaacaacctgaa
gatcaggcaataatcgtactcaacctgaccccggtaccccggcctgactatttcgtgcca
ttacccgaagacggcgactggcggatagttttttccagtgacaaccatcgcttcggcggc
accggccggcctgagtacagtcgaatatcgggttccggtaatactccggcctcacaatcg
ggcgtcagcctgcacctgccacctctcggcggtatcgtcctgataccggatagttga

DBGET integrated database retrieval system