KEGG   Dehalogenimonas lykanthroporepellens: Dehly_0627Help
Entry
Dehly_0627        CDS       T01264                                 

Definition
(RefSeq) pyruvate flavodoxin/ferredoxin oxidoreductase domain-containing protein
  KO
K00169  
pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
dly  Dehalogenimonas lykanthroporepellens
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dly00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dehly_0627
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dehly_0627
   00020 Citrate cycle (TCA cycle)
    Dehly_0627
   00620 Pyruvate metabolism
    Dehly_0627
   00640 Propanoate metabolism
    Dehly_0627
   00650 Butanoate metabolism
    Dehly_0627
  Energy metabolism
   00680 Methane metabolism
    Dehly_0627
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Dehly_0627
Enzymes [BR:dly01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Dehly_0627
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(591442..592614)
Genome map
AA seq 390 aa AA seqDB search
MSKRVGVEVSIALGDAVKMVNPDVIAAYPITPQTHIVEHLAELVAQGELDAEYVPVESEH
SAMSACLGSAAAGARTFTATAGQGLELMHEVLYVASGMRLPIVMAVVNRALSAPLSVWGD
HSDAMAVRDTGWIQIFTENGQEVVDQTICAFKIAEHHDVLFPVMVHLDGFHLSHVIEPIE
MPDEKKVCEYLPANTNPFTLHPSKPIAMGDFAPPVVFTEAKWAQEKAMLGVKKVINEIWD
EFAVKFGRTYKPVECYKCEGVKNVLVTMGSYSETAMTAVDNLREKGEDIGLIRIRLWRPF
PFEELRAVLKGVENVIVLDRSISPGASGTVASEIKSAMYTEKEKPTVKSYIGGLGGRDIT
VEGFEDLIKDGISDRNEYNGIEFQMVGVRE
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaacgtgttggtgttgaagtatcgattgccttaggtgatgccgtcaaaatggta
aatccggatgtcattgccgcttatcccataaccccacaaactcatattgtggaacatctt
gcagaattggttgctcaaggagaacttgatgctgaatacgtacctgtagaatctgaacat
tcagcaatgagtgcctgtttaggctctgcggccgcgggcgcccgtacatttacggctacc
gcaggccagggtttggaattgatgcatgaagtgctatatgtcgcttccggaatgcgttta
ccaattgtcatggctgttgttaaccgtgccttatcagctccgttgtctgtatggggagat
cattctgatgccatggcggtaagggataccggatggatccagatttttactgaaaatgga
caagaagtggtagaccaaactatctgtgcttttaagattgcggaacaccatgatgtgtta
ttccctgtgatggtccatttggacgggtttcacctgtcgcatgtaatcgaacctattgaa
atgccggatgagaaaaaagtctgcgagtatttgccggctaatacaaatccattcacccta
catccttccaaaccgattgccatgggagattttgcgccaccggtggtatttactgaagcc
aaatgggctcaggagaaagccatgctgggggttaaaaaggtaataaatgagatatgggat
gaattcgctgttaaatttggcaggacctataagccggtcgagtgttataaatgtgaaggc
gtaaagaatgttcttgtgaccatgggtagttattccgaaaccgccatgacagccgtcgat
aatcttagggaaaaaggcgaggatatcggtctgattagaattcgcttatggcgtcctttc
ccttttgaagaattgagagcagttctgaaaggcgtagaaaacgttattgtcctggaccga
agtatttcgcccggagcttcagggacggtagcttccgaaatcaaatcggctatgtatacc
gaaaaagaaaaaccgactgttaagagctatatcggcggccttggtggcagggatattacc
gtagaagggttcgaagacctgataaaagacggcataagtgaccggaatgaatataacggt
atcgagtttcagatggtaggggtcagagaataa

DBGET integrated database retrieval system