KEGG   Dehalogenimonas lykanthroporepellens: Dehly_0648Help
Entry
Dehly_0648        CDS       T01264                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme (EC:4.2.1.20)
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dly  Dehalogenimonas lykanthroporepellens
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dly00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dehly_0648
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dehly_0648
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Dehly_0648
Enzymes [BR:dly01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Dehly_0648
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
613028..614392
Genome map
AA seq 454 aa AA seqDB search
MEHTKYLLTEKEIPTSWYNIQADLPEPLAPSIHPGTKKPIGPADLAPLFPMELIMQEVSQ
ERYIDIPGEVIDIYKAWRPTTLYRARALEKALDTPAKIFYKYEGSSPAGSHKPNTAVPQA
FYNKKEGINRLTTETGAGQWGSSMAFACSQFGIELKVYMVKVSYQQKPYRRMMMETWGAE
CVPSPSPDTASGRAALAENPDNPGSLGLAISEAVEDAAPRSDSHYALGSVLNHVLMHQTM
IGLESLKQMEMAGEYPDVVIGCVGGGSNFGGMALPFVHQNITQGKNTRIVAVEPSSCPTL
TKGKFNFDYGDVAGMAPIVKMFTLGHKFMPPPVHAGGLRYHGMAPIVSHLYNLGLIEAKA
VQQLPTFEAGIQFARTEGFISAPETNHAIRATIDEALRCRESGESKVILFNHSGHGHFDL
AAYDAYMSGKLADYDYPESLVAEALKDLPKCLID
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atggaacacaccaagtatttactgacagaaaaggaaatacccaccagttggtacaacatt
caggctgatttgccggaaccattagcaccctctattcatcccgggacgaagaaaccaata
ggtcccgctgatctggcgcctctttttcccatggagctgatcatgcaagaggtctctcag
gaaagatacatagacattcctggcgaagtcattgatatctacaaagcatggaggccgacc
acgttataccgggcacgagctcttgaaaaggctttggacacacccgctaaaatattttac
aaatatgaaggttccagcccggccggaagccacaaacctaatacggctgtgccacaggca
ttttacaacaagaaagaaggtattaaccggttgactacggaaaccggagcaggtcagtgg
ggcagttccatggctttcgcctgcagtcagttcggcattgaattgaaggtgtatatggtg
aaggtcagctatcaacaaaaaccatatcgtcgtatgatgatggaaacttggggagccgag
tgcgtccccagccccagtccggataccgcttctggtagggcggccttggcggaaaatccc
gacaatccgggtagtctcggtctggcaatttccgaagccgtcgaagacgcagccccccga
agtgattcccactatgctttgggtagtgttttgaaccatgtactgatgcatcagacgatg
atcggtctggaatcactgaaacagatggaaatggcaggggagtaccctgatgtggttatc
ggctgtgtcggcggcggctcaaatttcggtggtatggcattgccttttgttcatcagaac
atcactcaagggaaaaatacccgtattgtggctgttgagccttcgagttgcccgactttg
actaaaggaaaattcaacttcgattacggtgatgtggcaggaatggcgccaattgttaag
atgtttactcttggccataaattcatgccgcctccggtacatgctggggggctacgttat
catggtatggcgccgattgtcagtcatttatacaatctgggattgatcgaagccaaggca
gtacagcaactaccgacttttgaggctgggattcagtttgcaagaacagaaggatttatc
agcgcacctgaaaccaatcatgccatcagggcgaccattgatgaagccctgagatgtcgt
gaatccggagagagtaaggtcatcttgtttaaccactcaggtcacggacattttgatttg
gcggcttatgatgcctatatgtccggaaagctcgctgattatgattatccggaatccttg
gttgctgaggccttgaaggatttgcctaaatgcctcattgattaa

DBGET integrated database retrieval system