KEGG   Dehalogenimonas lykanthroporepellens: Dehly_0654Help
Entry
Dehly_0654        CDS       T01264                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
dly  Dehalogenimonas lykanthroporepellens
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:dly01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:dly00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
622521..623789
Genome map
AA seq 422 aa AA seqDB search
MKVIFGFEQGRRALDRTGSLPSVDANLEAVVSKIVESVRINGDNALKALTREYDGVQLES
FEVAKPEIEAAKSCVDIELLRALDYAANRILDYHQIQKTNIDSYFSLMKGRQLSRPLERV
GLYAPGGKAYYPSTVLMTALPAKAAGAGTIYLATPPGPEGKIPAPTLAAAAIAGVDGVFS
IGGAQAIAAFAYGTQCIPRVDKICGPGNKFVMTAKKLVFGDVAIDGLQGPSEVLIIADSN
SNPRYCATDMLAQAEHDPDATSVLVTTSEKLARNVLGEIKEIGNSNSRHDIIVQSLNAKG
KIIIVDNIDEAIELSNIYAPEHLCLLSEQASARLADFKHAGCVFTGPSATVAIGDYVAGP
SHALPTSGTARFSSPLNVWDFLKIIDVVDVDNELIQQSGHVAVTIAEAEGLSAHALAIKS
RM
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcatttttggctttgaacaagggcgccgcgcactggaccggaccggttcattg
ccttctgtcgacgcaaatctggaagctgtcgtcagtaaaatcgttgagtctgtgagaata
aatggtgataacgccctgaaggcactgactcgggaatatgacggtgttcaacttgaatct
tttgaagtagctaaaccagaaatagaagccgcgaaatcctgtgtagatattgaacttctt
cgcgcgttagattatgccgccaaccgcattcttgattaccatcaaattcagaaaaccaat
atagattcgtatttttcacttatgaaaggccgtcagctgtcccgtcctttagaacgagtc
ggattatacgccccgggcggcaaagcctattatccctcaaccgttttgatgacggctctt
ccggctaaggcggctggggccggaactatctatcttgccacccctcccggtcccgaagga
aaaattccggcacctacgctggcggcagctgccattgccggagttgatggtgtattctcc
atcggtggggcgcaagctattgccgccttcgcttatggcacccaatgcattcctcgcgtt
gataagatatgtgggcctggaaataaatttgtaatgaccgcaaaaaagttggtttttgga
gatgtagccatcgacgggttacaggggccgagcgaggtcttaataattgccgacagtaat
tctaatccgcgttattgtgctaccgatatgctggcacaggctgaacatgatcctgatgcc
acatcggttttggttacgacctccgaaaaattggccagaaatgttctcggcgagatcaag
gaaatcggtaatagtaacagtcgtcacgatatcatcgtgcaatcacttaacgccaaaggc
aaaatcataattgtggataatatcgatgaggcaatcgagttgtctaatatttacgccccg
gaacacctttgccttctatcggagcaagcttccgctcgattggcagatttcaagcatgcg
ggttgtgtctttaccggcccaagtgctactgtagctattggggattatgtcgccggtccc
agtcacgcattaccgacatccgggacagccaggttttcctctcccttgaatgtatgggat
ttccttaagataatcgatgttgtggacgtagacaatgaactgatacaacaatcgggccat
gtggctgtaaccattgctgaagcggaaggtttatcagcgcatgctttggcaataaagtcc
aggatgtaa

DBGET integrated database retrieval system