KEGG   Dehalogenimonas lykanthroporepellens: Dehly_0699Help
Entry
Dehly_0699        CDS       T01264                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dly  Dehalogenimonas lykanthroporepellens
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:dly00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dehly_0699
   01230 Biosynthesis of amino acids
    Dehly_0699
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dehly_0699
   00051 Fructose and mannose metabolism
    Dehly_0699
   00562 Inositol phosphate metabolism
    Dehly_0699
Enzymes [BR:dly01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Dehly_0699
Exosome [BR:dly04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Dehly_0699
  Exosomal proteins of bladder cancer cells
   Dehly_0699
  Exosomal proteins of melanoma cells
   Dehly_0699
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(671043..671801)
Genome map
AA seq 252 aa AA seqDB search
MSERPTVIAGNWKMHTTVDEAVELVGEMSSALAEFENVEVIICPPFIALCKVKELLGQAN
RIQLGAQNMYQEAKGAFTGEISPVMLQDFCKYVIIGHSERREIFQETDDMIKLKVRAALK
FGLKPILCVGENLAQREGGKVQEVIEGQITKALDGVNSPDIYVAYEPVWAIGTGRAATGD
IANETAMLIRNIVGKLYGNAVSQALPVLYGGSVNPENISDFISRSDIDGALVGGASIKAG
QFVEIVRKSVQS
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaagacccacggtaatcgccggtaactggaaaatgcataccacagtggatgag
gcggtagaactagtcggagaaatgtcttcagctctggctgagttcgaaaatgtcgaggtg
ataatttgtccaccttttatcgctttgtgcaaggttaaggagttgctgggccaagccaac
cgaattcaacttggcgctcagaatatgtaccaggaagccaaaggcgcattcaccggcgaa
atatcaccggtaatgttgcaggatttctgtaaatatgtcattatcgggcattccgaacga
cgtgaaatattccaggaaaccgatgatatgataaaattgaaagtaagggccgcgttgaaa
tttggactgaaaccgatactatgtgtaggggaaaacctggctcaacgtgaaggtgggaaa
gtgcaagaggttatcgaaggccagattaccaaggcgctggatggggtgaattcgcccgat
atttatgtagcttacgaaccggtttgggcaataggaaccggacgggcggctacaggtgat
atcgccaatgaaaccgcgatgctgatacgaaatatagtgggtaaactgtatggtaatgcc
gtcagccaagccttgccggtcctctatgggggcagtgtcaatcctgaaaatatttctgat
tttatttcacgtagcgatatcgatggagccctggtcggcggcgccagcataaaagccggt
cagtttgtagaaattgtcagaaaaagcgttcaatcctga

DBGET integrated database retrieval system