KEGG   Dehalogenimonas lykanthroporepellens: Dehly_0699Help
Entry
Dehly_0699        CDS       T01264                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dly  Dehalogenimonas lykanthroporepellens
Pathway
dly00010  Glycolysis / Gluconeogenesis
dly00051  Fructose and mannose metabolism
dly00562  Inositol phosphate metabolism
dly01100  Metabolic pathways
dly01110  Biosynthesis of secondary metabolites
dly01120  Microbial metabolism in diverse environments
dly01130  Biosynthesis of antibiotics
dly01200  Carbon metabolism
dly01230  Biosynthesis of amino acids
Module
dly_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:dly00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dehly_0699
   00051 Fructose and mannose metabolism
    Dehly_0699
   00562 Inositol phosphate metabolism
    Dehly_0699
Enzymes [BR:dly01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Dehly_0699
Exosome [BR:dly04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Dehly_0699
  Exosomal proteins of bladder cancer cells
   Dehly_0699
  Exosomal proteins of melanoma cells
   Dehly_0699
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADJ26006
UniProt: D8K078
Position
complement(671043..671801)
Genome map
AA seq 252 aa AA seqDB search
MSERPTVIAGNWKMHTTVDEAVELVGEMSSALAEFENVEVIICPPFIALCKVKELLGQAN
RIQLGAQNMYQEAKGAFTGEISPVMLQDFCKYVIIGHSERREIFQETDDMIKLKVRAALK
FGLKPILCVGENLAQREGGKVQEVIEGQITKALDGVNSPDIYVAYEPVWAIGTGRAATGD
IANETAMLIRNIVGKLYGNAVSQALPVLYGGSVNPENISDFISRSDIDGALVGGASIKAG
QFVEIVRKSVQS
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaagacccacggtaatcgccggtaactggaaaatgcataccacagtggatgag
gcggtagaactagtcggagaaatgtcttcagctctggctgagttcgaaaatgtcgaggtg
ataatttgtccaccttttatcgctttgtgcaaggttaaggagttgctgggccaagccaac
cgaattcaacttggcgctcagaatatgtaccaggaagccaaaggcgcattcaccggcgaa
atatcaccggtaatgttgcaggatttctgtaaatatgtcattatcgggcattccgaacga
cgtgaaatattccaggaaaccgatgatatgataaaattgaaagtaagggccgcgttgaaa
tttggactgaaaccgatactatgtgtaggggaaaacctggctcaacgtgaaggtgggaaa
gtgcaagaggttatcgaaggccagattaccaaggcgctggatggggtgaattcgcccgat
atttatgtagcttacgaaccggtttgggcaataggaaccggacgggcggctacaggtgat
atcgccaatgaaaccgcgatgctgatacgaaatatagtgggtaaactgtatggtaatgcc
gtcagccaagccttgccggtcctctatgggggcagtgtcaatcctgaaaatatttctgat
tttatttcacgtagcgatatcgatggagccctggtcggcggcgccagcataaaagccggt
cagtttgtagaaattgtcagaaaaagcgttcaatcctga

DBGET integrated database retrieval system