KEGG   Dehalogenimonas lykanthroporepellens: Dehly_0710Help
Entry
Dehly_0710        CDS       T01264                                 

Definition
phosphoglycerate mutase
Orthology
K02226  
alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
dly  Dehalogenimonas lykanthroporepellens
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:dly00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(684468..685091)
Genome map
AA seq 207 aa AA seqDB search
MKLILVRHGEIASAGTGICYGSTDVPLSEKGRTQAAALQKRFAMERIETFYSSTLQRGRD
TADIVSRLHSKTVKVDEAINEVNFGRIEQQTYDWVLKEYPDIAELWLSGSTEIAFPGGEN
FQSLIERSTMFIQRVIAEHGPGDTVMIVSHGGPLRIIICHLLGIPVSHHWQLTVERASVS
ILRLTGDKAVLDCLNDMSHCIEIEGTT
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
ttgaaactgatactggtcaggcatggggaaatagcttcagcgggtactgggatatgctac
gggtctaccgatgttcccctttcagagaaggggcgtacacaagcggcggctttacaaaaa
aggtttgccatggaacgcatcgaaaccttttattcttctactcttcagaggggacgtgat
acagctgatatagtgtcccggctacactcgaaaacagttaaggtcgatgaggccatcaat
gaagttaattttggtcgcattgaacaacagacatatgactgggtgctcaaggaatatccc
gatattgcggaattatggctgagcggcagtaccgagatagcttttcccggaggtgaaaac
tttcagtcactcattgaacgctccacgatgttcattcagcgagtgatagctgaacacggg
ccgggggatactgtcatgattgtgtctcatggggggcctttgaggattattatctgtcat
ttactggggatccctgtcagtcatcactggcaattgaccgtggagcgggcatcggtcagt
atactccggctgactggagataaggctgtgctggattgcctcaacgacatgtctcattgt
attgaaatagagggaacgacatga

DBGET integrated database retrieval system