KEGG   Dehalogenimonas lykanthroporepellens: Dehly_0912Help
Entry
Dehly_0912        CDS       T01264                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
dly  Dehalogenimonas lykanthroporepellens
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dly00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Dehly_0912
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Dehly_0912
Enzymes [BR:dly01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Dehly_0912
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
897215..898189
Genome map
AA seq 324 aa AA seqDB search
MTEATAPLETKSWHRRHILDVDDMSPEEFETIFRTADAMKDVLARPIRKVPALRGQMVVN
MFYENSTRTRASFEIAAKNLSADVLNMTASASSVTKGESLTDTIRTLEALGANIIVMRHQ
LSGAPYLAARHSHAAIVNGGDGWHAHPTQALLDLYTIRERKGTFKGLRAVIVGDIRHSRV
AHSNIWGMTRLGMQVTLCAPPTLLPYGLEKAGGMMPEVAVETDLDRAIQGADVVMTLRLQ
RERQQSGLLPSVGEYIRRYQVNETRLKKAATDALLMHPGPVNEDIELAASAAGGTASTID
RQVENGVAVRMAVLYLISGRQSEL
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagcaaccgctccgctggaaaccaaaagctggcatcgccggcatatactggac
gtcgatgacatgtcaccggaagaattcgaaaccatattccgaactgccgacgccatgaag
gacgtgctggcccgccccatccggaaggtgccggccttgcgcggccagatggtggtcaat
atgttctacgagaactccacccgcacccgcgcctccttcgaaatagccgccaagaatctg
tccgccgatgtcctgaacatgacggcctcggcctcatccgtcaccaagggcgagagcctg
accgataccatcaggacgctggaagcactgggcgccaatatcatagtgatgcgccatcag
ttgtccggagcgccctacctggccgcccgtcacagccacgcggctatcgttaacggcggc
gacggctggcacgcccacccgacccaggccctgctggacctgtacaccatccgggaacgc
aaaggcacgttcaagggactcagggcggtcatcgtcggcgatatccgccacagccgggtg
gcccactccaatatctggggcatgacccgcctgggtatgcaggtaacgttgtgcgccccg
ccgacactcctgccatacggtctggaaaaagccgggggaatgatgcccgaagttgccgtc
gagaccgacctggatagagctatccaaggcgctgacgtggtgatgacactgagactccag
cgggaacgccagcagagcgggcttctgccgtcggtgggcgaatatatcagacgctaccag
gtgaatgagacccggttgaaaaaggccgctaccgacgccctgctgatgcatcccggcccg
gtcaacgaagatatcgaactggccgcctcggcggccggcgggacagcttcgaccatcgac
cgacaggtggagaacggcgtggctgtccgcatggcggtcctgtacctcatcagcggcagg
cagagcgaattatga

DBGET integrated database retrieval system