KEGG   Dehalogenimonas lykanthroporepellens: Dehly_0912Help
Entry
Dehly_0912        CDS       T01264                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
dly  Dehalogenimonas lykanthroporepellens
Pathway
dly00240  Pyrimidine metabolism
dly00250  Alanine, aspartate and glutamate metabolism
dly01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dly00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Dehly_0912
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Dehly_0912
Enzymes [BR:dly01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Dehly_0912
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace Vsr
Motif
Other DBs
NCBI-ProteinID: ADJ26214
UniProt: D8K0T6
Position
897215..898189
Genome map
AA seq 324 aa AA seqDB search
MTEATAPLETKSWHRRHILDVDDMSPEEFETIFRTADAMKDVLARPIRKVPALRGQMVVN
MFYENSTRTRASFEIAAKNLSADVLNMTASASSVTKGESLTDTIRTLEALGANIIVMRHQ
LSGAPYLAARHSHAAIVNGGDGWHAHPTQALLDLYTIRERKGTFKGLRAVIVGDIRHSRV
AHSNIWGMTRLGMQVTLCAPPTLLPYGLEKAGGMMPEVAVETDLDRAIQGADVVMTLRLQ
RERQQSGLLPSVGEYIRRYQVNETRLKKAATDALLMHPGPVNEDIELAASAAGGTASTID
RQVENGVAVRMAVLYLISGRQSEL
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagcaaccgctccgctggaaaccaaaagctggcatcgccggcatatactggac
gtcgatgacatgtcaccggaagaattcgaaaccatattccgaactgccgacgccatgaag
gacgtgctggcccgccccatccggaaggtgccggccttgcgcggccagatggtggtcaat
atgttctacgagaactccacccgcacccgcgcctccttcgaaatagccgccaagaatctg
tccgccgatgtcctgaacatgacggcctcggcctcatccgtcaccaagggcgagagcctg
accgataccatcaggacgctggaagcactgggcgccaatatcatagtgatgcgccatcag
ttgtccggagcgccctacctggccgcccgtcacagccacgcggctatcgttaacggcggc
gacggctggcacgcccacccgacccaggccctgctggacctgtacaccatccgggaacgc
aaaggcacgttcaagggactcagggcggtcatcgtcggcgatatccgccacagccgggtg
gcccactccaatatctggggcatgacccgcctgggtatgcaggtaacgttgtgcgccccg
ccgacactcctgccatacggtctggaaaaagccgggggaatgatgcccgaagttgccgtc
gagaccgacctggatagagctatccaaggcgctgacgtggtgatgacactgagactccag
cgggaacgccagcagagcgggcttctgccgtcggtgggcgaatatatcagacgctaccag
gtgaatgagacccggttgaaaaaggccgctaccgacgccctgctgatgcatcccggcccg
gtcaacgaagatatcgaactggccgcctcggcggccggcgggacagcttcgaccatcgac
cgacaggtggagaacggcgtggctgtccgcatggcggtcctgtacctcatcagcggcagg
cagagcgaattatga

DBGET integrated database retrieval system